PMAP-23 is a biologically active peptide (an antimicrobial peptide (AMP) derived from porcine bone marrow). Product Details Product Name PMAP-23 Biological activity PMAP-23 is a biological active peptide. (an antimicrobial peptide (AMP) derived from porcine myeloid.) Appearance Solid Color White to off-white Sequence Arg-Ile-Ile-Asp-Leu-Leu-Trp-Arg-Val-Arg-Arg-Pro-Gln-Lys-Pro-Lys-Phe-Val-Thr-Val-NH2 Sequence Shortening RIIDLLWRVRRPQKPKFVTVWVR-NH2 Storage Sealed storage, away from moisture
PMAP-36 is an antimicrobial peptide with the sequence GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. Product Details Product Name PMAP-36 Biological activity PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance. Appearance Solid Color White to light yellow Sequence Gly-Arg-Phe-Arg-Arg-Leu-Arg-Lys-Lys-Thr-Arg-Lys-Arg-Leu-Lys-Lys-Ile-Gly-Lys-Val-Leu-Lys-Trp-Ile-Pro-Pro-Ile-Val-Gly-Ser-Ile-Pro-Leu-Gly-Cys-Gly Sequence Shortening GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG Storage Sealed storage, away from moisture
PNC-27, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 is an anticancer peptide. PNC-27 can be used in acute myeloid leukemia research. Product Information Product Name PNC-27 Molecular Weight 4031.73 Formula C188H293N53O44S CAS Number 1159861-00-3 Appearance Solid Color White to…
PNC-27 acetate, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 acetate is an anticancer peptide. PNC-27 acetate can be used in acute myeloid leukemia research. Product Information Product Name PNC-27 acetate Molecular Weight 4031.73 (free base) Formula C188H293N53O44S.xC2H2O2 Appearance Solid…
PNC-28 is a peptide from the mdm-2-binding domain (residues 17?C26) of the p53 protein which contains a membrane crossing-penetratin sequence. PNC-28 can be used for pancreatic cancer research. Product Information Product Name PNC-28 Molecular Weight 3509.13 Formula C164H255N47O37S CAS Number 392661-17-5 Appearance Solid Color White to off-white Sequence Shortening ETFSDLWKLLKKWKMRRNQFWVKVQRG Sequence Shortening ETFSDLWKLLKKWKMRRNQFWVKVQRG Storage Sealed…
PNC-28 acetate is a peptide from the mdm-2-binding domain (residues 17?C26) of the p53 protein which contains a membrane crossing-penetratin sequence. PNC-28 acetate can be used for pancreatic cancer research. Product Information Product Name PNC-28 acetate Molecular Weight 3509.13 (free acid) Formula C164H255N47O37S.xC2HF3O2 Appearance Solid Color White to off-white Sequence Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly Sequence Shortening ETFSDLWKLLKKWKMRRNQFWVKVQRG Storage…
Polistes mastoparan is an antimicrobial peptide. Polistes mastoparan increases K+ efflux from S. aureus and inhibits S. aureus viability, with an EC50 of 5 ??M. Product Details Product Name Polistes mastoparan Biological activity Polistes mastoparan is an antimicrobial peptide. Polistes mastoparan increases S. aureus cell K+ efflux and inhibits cell viability with EC50 of 5…
Polyalanine peptide (pALA) is an antimicrobial peptide targeting biofilms and Gram-negative bacteria, and is non-toxic to mammalian cells. Polyalanine peptide forms an ??-helical conformation that effectively permeabilizes Gram-negative bacterial membranes, thereby inducing lethal cell leakage. Polyalanine peptide can be used in anti-infection research. Product Details Product Name Polyalanine peptide Biological activity Polyalanine peptide (pALA) is…
Polybia-MP1 is an antimicrobial peptide with antibacterial, antifungal, and anticancer activities. Polybia-MP1 selectively targets cancer cells by interacting with PS and PE in the outer leaflet of the cell membrane, inducing necrosis through pore formation. Polybia-MP1 exhibits antibacterial activity against Pseudomonas aeruginosa. Polybia-MP1 can be used in research on bacterial infections, fungal infections, and cancer….
Polymyxin B nonapeptide is a cationic cyclic peptide. Polymyxin B nonapeptide is a derivative produced by enzymatic cleavage of Polymyxin B. Compared with Polymyxin B, Polymyxin B nonapeptide has lower toxicity and lacks bactericidal activity, but retains the ability to disrupt the outer membrane of Gram-negative bacteria. Product Details Product Name Polymyxin B nonapeptide Biological…
Polymyxin B nonapeptide TFA is a cationic cyclic peptide. Polymyxin B nonapeptide TFA is a derivative produced by enzymatic cleavage of Polymyxin B. Compared with Polymyxin B, Polymyxin B nonapeptide TFA has lower toxicity and lacks bactericidal activity, but retains the ability to disrupt the outer membrane of Gram-negative bacteria. Product Details Product Name Polymyxin…
Polymyxin B Sulfate is an antibiotic. Polymyxin B Sulfate inhibits Gram-negative bacterial infection by binding with high affinity to LPS of the bacterial wall. Polymyxin B Sulfate can neutralize the effects of endotoxin. Polymyxin B Sulfate induces bacterial death by increasing its permeability. Polymyxin B Sulfate can be used in research on endotoxemia. Product Details…
Polymyxin B1 is a potent antibacterial lipopeptide derived from Paenibacillus polymyxa. Polymyxin B1 is the major component of Polymyxin B (HY-A0248). Polymyxin B1 induces bacterial cell lysis through interaction with the bacterial cell membrane. Polymyxin B1 can be used in research on multidrug-resistant Gram-negative bacterial infections. Product Details Product Name Polymyxin B1 Biological activity Polymyxin…
Polymyxin B1-D-Leu-d7 TFA is a deuterium-labeled Polymyxin B1 (HY-A0248A). Polymyxin B1 is a potent antibacterial lipopeptide derived from Paenibacillus polymyxa. Polymyxin B1 is the major component of Polymyxin B (HY-A0248). Polymyxin B1 induces bacterial cell lysis through interaction with the bacterial cell membrane. Polymyxin B1 can be used in research on multidrug-resistant Gram-negative bacterial infections….
Polymyxin B1-d7 TFA is a deuterated form of Polymyxin B1 TFA (HY-A0248A). Polymyxin B1 is a potent antibacterial lipopeptide derived from Paenibacillus polymyxa. Polymyxin B1 is the major component of Polymyxin B (HY-A0248). Polymyxin B1 induces bacterial cell lysis through interaction with the bacterial cell membrane. Polymyxin B1 can be used in research on multidrug-resistant…
Polymyxin B2 is a polypeptide antibiotic with antibacterial activity particularly against Gram-negative bacteria. Polymyxin B2 binds to lipopolysaccharide molecules on the bacterial cell membrane, disrupting membrane integrity and causing leakage of cellular contents, thereby killing bacteria. Polymyxin B2 can be used in research on Pseudomonas aeruginosa infection and acute enteritis. Product Details Product Name Polymyxin…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
