-GLP-1(7-37) acetate is a derivative of GLP-1 containing alanine-to-glycine substitution at positions 8. Product Information Product Name -GLP-1(7-37) acetate Molecular Weight 3341.64 (free base) Formula C150H226N40O47.xC2H4O2 Appearance Solid Color White to off-white Sequence His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Sequence Shortening HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6…
-Substance P TFA is a tachykinin NK1 receptor selective agonist. Product Information Product Name -Substance P TFA Molecular Weight 1507.68 Formula C66H101F3N18O17S CAS Number 2828433-10-7 Appearance Solid Color White to off-white Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-{Sar}-Leu-Met-NH2 Sequence Shortening RPKPQQFF-{Sar}-LM-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months;…
Angiotensin amide ((Asn1,Val5)-Angiotensin II) is a potent vasoconstrictor. Angiotensin amide is a derivative of angiotensin II. Angiotensin amide can be used as a cardiac activator. Product Information Product Name (Asn1,Val5)-Angiotensin II Molecular Weight 1031.17 Formula C49H70N14O11 CAS Number 53-73-6 Sequence Shortening NRVYVHPF Sequence Shortening NRVYVHPF
(D-His1)-Exenatide is one od impurities of Exenatide. Product Information Product Name (D-His1)-Exenatide Molecular Weight 4186.57 Formula C184H282N50O60S CAS Number 1678417-09-8 Sequence {d-His}-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Sequence Shortening {d-His}-GEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
(R)-Zadavotide guraxetan ((R)-PSMA I&T) is the R-enantiomer of Zadavotide guraxetan (HY-148761). Zadavotide guraxetan is a potent prostate-specific membrane antigen (PSMA) inhibitor. (R)-Zadavotide guraxetan exhibits antitumor activity. Product Information Product Name (R)-Zadavotide guraxetan Molecular Weight 1498.37 Formula C63H92IN11O23 CAS Number 2647371-60-4 Sequence (R)-DOTA-{3-I-dTyr}-{dPhe}-{dLys-C8 diacid-eLys}-Glu Sequence Shortening (R)-DOTA-{3-I-dTyr}-{dPhe}-{dLys-C8 diacid-eLys}-E
α-Myosin (614-643) is a segment of polypeptide of the heavy chain of cardiac α-myosin. α-Myosin has a strong ability to induce autoimmune myocarditis. Product Information Product Name α-Myosin (614-643) Molecular Weight 3047.44 Formula C132H220N36O44S CAS Number 176373-77-6 Sequence Ac-Ser-Leu-Lys-Leu-Met-Ala-Thr-Leu-Phe-Ser-Thr-Tyr-Ala-Ser-Ala-Asp-Thr-Gly-Asp-Ser-Gly-Lys-Gly-Lys-Gly-Gly-Lys-Lys-Lys-Gly Sequence Shortening Ac-SLKLMATLFSTYASADTGDSGKGKGGKKKG
β-CGRP (mouse) (Calcitonin gene-related peptide 2 (mouse)) is a calcitonin gene-related peptide. β-CGRP (mouse) has important physiological functions in the sensory nervous system. β-CGRP may be involved in nociceptive processes. β-CGRP (mouse) plays distinct roles in the neuromuscular system and the gastrointestinal system. Product Information Product Name β-CGRP (mouse) Molecular Weight 3879.29 Formula C165H265N49O55S2 Appearance…
β-Corticotropin (swine) is a synthetic form of the peptide hormone corticotropin (ACTH). β-Corticotropin stimulates steroid release. Product Information Product Name β-Corticotropin (swine) CAS Number 12427-33-7
β-Interleukin I (163-171), human, an immunostimulatory fragment of human IL-1β peptide, is a T cell activator. β-Interleukin I (163-171), human is not an IL-1R-binding domain of IL-1β. β-Interleukin I (163-171), human is a potent adjuvant that enhances the immune response in a variety of exptl. situations. Product Information Product Name β-Interleukin I (163-171), human Molecular…
4F-P-4F peptide is an apoA-I mimetic peptide with a class A amphipathic α-helical structure that acts on ABCA1 and SR-B. 4F-P-4F peptide induces cholesterol efflux from cholesterol-loaded mouse macrophages and promotes HDL remodeling in plasma. 4F-P-4F peptide can be used in research on asthma and atherosclerosis. Product Information Product Name 4F-P-4F peptide Molecular Weight 4618.20…
A-30912A nucleus hydrochloride is the product of Echinocandin B (ECB) deacylase-catalyzed antifungal agent A-30912A (HY-125723). Product Information Product Name A-30912A nucleus hydrochloride Molecular Weight 834.27 Formula C34H52ClN7O15 CAS Number 1029890-89-8 Appearance Solid Color White to off-white Storage RT, stored under nitrogen, away from moisture In solvent -80??C 1 year -20??C 6 months
Abaloparatide (BA 058) is a parathyroid hormone receptor 1 (PTHR1) analog. Abaloparatide also is a selective PTHR1 activator. Abaloparatide enhances Gs/cAMP signaling and β-arrestin recruitment. Abaloparatide enhances bone formation and cortical structure in mice. Abaloparatide has the potential for the research of osteoporosis. Product Information Product Name Abaloparatide Molecular Weight 3960.59 Formula C174H300N56O49 CAS Number…
Abaloparatide TFA (BA 058 TFA) is a parathyroid hormone receptor 1 (PTHR1) analogue. Abaloparatide TFA also is a selective PTHR1 activator. Abaloparatide TFA enhances Gs/cAMP signaling and β-arrestin recruitment. Abaloparatide TFA enhances bone formation and cortical structure in mice. Abaloparatide TFA has the potential for the research of osteoporosis. Product Information Product Name Abaloparatide TFA…
Abarelix (R3827; PPI 149) is a potent gonadotrophin-releasing hormone (GnRH) antagonist, used for prostate cancer treatment. Product Information Product Name Abarelix Molecular Weight 1416.06 Formula C72H95ClN14O14 CAS Number 183552-38-7 Appearance Solid Color White to off-white Sequence Shortening Ac-{d-2-Nal}-{d-4-Cpa}-{d-3-Pal}-S-{NMyr}-{d-Asp}-L-K(ipr)-P-{d-Ala}-NH2 Sequence Shortening Ac-{d-2-Nal}-{d-4-Cpa}-{d-3-Pal}-S-{NMyr}-{d-Asp}-L-K(ipr)-P-{d-Ala}-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In…
Abarelix Acetate (PPI 149 Acetate; R 3827 Acetate) is a potent gonadotrophin-releasing hormone (GnRH) antagonist, used for prostate cancer research. Product Information Product Name Abarelix Acetate Molecular Weight 1476.12 Formula C74H99ClN14O16 CAS Number 547741-72-0 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent…
Abecomotide is a biological active peptide. (an immunological agent for active immunization) Product Information Product Name Abecomotide Molecular Weight 1058.19 Formula C45H79N13O16 CAS Number 907596-50-3 Sequence Lys-Thr-Val-Asn-Glu-Leu-Gln-Asn-Leu Sequence Shortening KTVNELQNL
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
