Insert HTML here
Showing 3217–3232 of 3705 results
Peptide 5f is an antimicrobial peptide derived from bumblebee venom. Peptide 5f has antibacterial activity against bacteria and fungi. Peptide 5f has almost no hemolytic activity against human erythrocytes. Product Details Product Name Peptide 5f Biological activity Peptide 5f is an antimicrobial peptide derived from wasp venom. Peptide 5f has antimicrobial activity against bacteria and…
Peptide 5g is an antimicrobial peptide. Peptide 5g inhibits E. coli, S. aureus, and C. albicans with MIC values of 30, 10, and 12.5 ??g/mL, respectively. Product Details Product Name Peptide 5g Biological activity Peptide 5g is an antimicrobial peptide. Peptide 5g inhibits E. coli, S. aureus, and C. albicans with MIC values of 30,…
Peptide HV2 is an antibiotic that exerts anti-inflammatory effects by inhibiting TNF-??. Peptide HV2 has antibacterial activity. Product Details Product Name Peptide HV2 Biological activity Peptide HV2 is an antibiotic that exerts anti-inflammatory effects by inhibiting TNF-??. Peptide HV2 has antibacterial activity. Sequence Shortening RRVHVH-{dVal}-PGVHVHVRR-NH2 Storage Please store the product under the recommended conditions in…
Peptide P2.2 is a non-ribosomal peptide and an antimicrobial peptide. Peptide P2.2 has potent antibacterial activity, with MIC50 values of 4 ??M and 32 ??M against V. parahaemolyticus and V. alginolyticus, respectively. Peptide P2.2 combined with antibiotics (such as Ofloxacin (HY-B0125) and Linezolid (HY-10394)) enhances synergistic antibacterial effects, with negligible hemolytic activity. Peptide P2.2 disrupts…
Product Name Pancreastatin (33-49), porcine Biological activity Pancreastatin (33-49), porcine is a pancreastatin fragment. Pancreastatin is a peptide isolated from porcine pancreas which has insulin-suppressive actions in vitro. Pancreastatin (33-49), porcine enhances the priming effect of glucose. CAS Number 106507-61-3 Sequence Shortening Sequence Shortening QEEEEETAGAPQGLFRG-NH2 Storage Please store the product under the recommended conditions in…
Product Name Neuropeptide S (human) Biological activity Neuropeptide S human, a neuropeptide, is a potent cognate neuropeptide S receptor (NPSR) agonist. Neuropeptide S human can be used for Alzheimer’s disease (AD) research. Molecular Weight 2187.48 Formula Formula C93H155N31O28S CAS Number 412938-67-1 Appearance Solid Color White to off-white Sequence Sequence Ser-Phe-Arg-Asn-Gly-Val-Gly-Thr-Gly-Met-Lys-Lys-Thr-Ser-Phe-Gln-Arg-Ala-Lys-Ser Sequence Shortening Sequence Shortening SFRNGVGTGMKKTSFQRAKS
Peptide YY (PYY) (3-36), Human is an endogenous appetite-suppressing peptide that acts as a selective agonist of neuropeptide Y (NPY) Y2 receptor. Peptide YY (PYY) (3-36), Human inhibits intestinal fluid secretion, colonic propulsion, and reduces fecal output in mouse models. Peptide YY (PYY) (3-36), Human inhibits dmPGE2-, 5HT (HY-B1473A)-, and Castor oil (HY-107799)-induced diarrhea in…
Product Name ACTH (4-11) Biological activity ACTH (4-11), an adrenocorticotropin hormone fragment, possesses a weak α-melanocyte stimulating hormone (α-MSH) potency only at high doses (100 and 1000 nM). Formula Formula C50H71N15O11S CAS Number 67224-41-3 Appearance Solid Color White to off-white Sequence Sequence Met-Glu-His-Phe-Arg-Trp-Gly-Lys Sequence Shortening Sequence Shortening MEHFRWGK Storage Sealed storage, away from moisture and…
Product Name Cholecystokinin Biological activity Cholecystokinin is a peptide hormone. Cholecystokinin, as a hunger suppressant, inhibits food intake and stimulates the digestion of fat and protein. Cholecystokinin can be used for the research of gastrointestinal system. Formula Formula C167H263N51O52S4 CAS Number 9011-97-6 Appearance Solid Color White to off-white Sequence Sequence Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Ile-Val-Lys-Asn-Leu-Gln-Asn-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-{Tyr(SO3H)}-Met-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening…
Product Name Neuropeptide Y (human,rat,mouse) TFA Biological activity Neuropeptide Y (human) TFA is involved in Alzheimer’s disease (AD) and protects rat cortical neurons against β-Amyloid toxicity. Formula Formula C191H286F3N55O59S Appearance Solid Color White to off-white Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 Storage Sealed storage, away from moisture and light, under nitrogen Powder -80??C…
Product Name Neuropeptide S (mouse) Biological activity Neuropeptide S (mouse) is a bioactive peptide. Neuropeptide S (mouse), as a neurotransmitter/neuromodulator of 20 amino acids, can be used for the research of arousal, anxiety, locomotion, feeding behaviors, memory and agent addiction. CAS Number 412938-74-0 Appearance Solid Color White to off-white Sequence Sequence Ser-Phe-Arg-Asn-Gly-Val-Gly-Ser-Gly-Ala-Lys-Lys-Thr-Ser-Phe-Arg-Arg-Ala-Lys-Gln Sequence Shortening Sequence…
Product Name Spexin-2 (53-70), human,mouse,rat Biological activity Spexin-2 (53-70), human,mouse,rat (NPQ 53-70) is a biological active peptide. (This is Spexin-2 (53-70), non-amidated version of the novel peptide hormone that is derived from prohormone proNPQ and is conserved amongst mammalian species. It is a central modulator of cardiovascular and renal function. Spexin-2, when administered to rats,…
PepW is a potent antimicrobial peptide targeting the capsule of multidrug-resistant Klebsiella pneumoniae (MIC=2-8 ??M). PepW achieves bactericidal effects through capsular polysaccharide aggregation and structural disruption. PepW is expected to be used in research on infectious diseases caused by Gram-negative bacteria (such as pneumonia and sepsis). Product Details Product Name PepW Biological activity PepW is…
Product Name β-CGRP, human TFA Biological activity β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells. Molecular Weight 3793.41 (free base) Formula Formula C162H267N51O48S3.xC2HF3O2 Appearance Solid Color…
Periplanetasin-2 is an antimicrobial peptide that induces oxidative stress by producing reactive oxygen species (ROS) and lipid peroxidation. Periplanetasin-2 can induce apoptosis. Product Details Product Name Periplanetasin-2 Biological activity Periplanetasin-2 is an antifungal peptide that induces oxidative stress through the production of reactive oxygen species (ROS) and lipid peroxidation. Periplanetasin-2 can also induce apoptosis. Sequence…
Periplanetasin-4 is an antimicrobial peptide that can be extracted from the American cockroach (Periplaneta americana). Periplanetasin-4 reduces cell rounding and apoptosis. Periplanetasin-4 blocks Clostridium difficile toxin A-induced ROS production and downstream activation of p38 MAPK and p21. Periplanetasin-4 significantly increases mitochondrial calcium levels in Candida albicans ATCC 90028 cells, decreases DPH fluorescence intensity, and causes…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us