Insert HTML here
Showing 3281–3296 of 3705 results
Polyphemusin I is a natural antimicrobial peptide with excellent antibacterial activity against Gram-negative and Gram-positive bacteria. Polyphemusin I contains 18 amino acids and is stabilized by two disulfide bridges into an amphipathic antiparallel ??-hairpin. Product Details Product Name Polyphemusin I Biological activity Polyphemusin I is a natural antimicrobial peptide with excellent antimicrobial activity against Gram-negative…
Polyphemusin II is an antimicrobial peptide that can be isolated from the hemocytes of the American horseshoe crab. Polyphemusin II has antibacterial activity against a variety of Gram-positive and Gram-negative bacteria as well as fungi. Product Details Product Name Polyphemusin II Biological activity Polyphemusin II is an antimicrobial peptide which can be isolated from Limulus…
Porcine dynorphin A (1-13) is a potent, endogenous ?? opioid receptor agonist and is antinociceptive at physiological concentrations. Product Information Product Name Porcine dynorphin A(1-13) Molecular Weight 1603.95 Formula C75H126N24O15 CAS Number 72957-38-1 Appearance Solid Color White to off-white Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys Sequence Shortening YGGFLRRIRPKLK Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C…
Poterepatide (HDM1005) is a GLP-1R/GIPR dual agonist. Poterepatide preferentially reduces fat mass and improves hepatic steatosis in a dose-dependent manner, improving lipid metabolism and liver function. Poterepatide can be used in research on type 2 diabetes, obesity, and metabolic dysfunction-associated steatohepatitis. Product Information Product Name Poterepatide Molecular Weight 5199.94 Formula C243H382N52O73 CAS Number 3058127-20-8 Appearance…
PP102 is an antimicrobial peptide with antibacterial activity against Gram-negative and Gram-positive bacteria, with MICs against B. subtilis (25 uM), S. aureus (13 uM), S. lutea (63 uM), and B. pumilus (23 uM). Product Details Product Name PP102 Biological activity PP102 is an antimicrobial peptide is active against gram-positive B. subtilis (MIC: 25 uM), S….
PP113 is an antimicrobial peptide with antibacterial activity against Gram-negative and Gram-positive bacteria, with MICs against E. coli (73.3 uM), B. subtilis (23.3 uM), S. aureus (13 uM), S. lutea (16.7 uM), and B. pumilus (23.3 uM). Product Details Product Name PP113 Biological activity PP113 is an antimicrobial peptide is active against Gram-negative and Gram-positive…
PP13 is an antimicrobial peptide with antibacterial activity against Gram-negative and Gram-positive bacteria, with MICs against E. coli (16.7 uM), B. subtilis (13.3 uM), S. aureus (23.3 uM), S. lutea (8.0 uM), and B. pumilus (9.0 uM). Product Details Product Name PP13 Biological activity PP13 is an antimicrobial peptide, and is active against Gram-negative and…
PR-39 is a proline- and arginine-rich natural antimicrobial peptide and a non-competitive, reversible, allosteric proteasome inhibitor. PR-39 reversibly binds to the ??7 subunit of the proteasome and blocks the degradation of the NF-??B inhibitor I??B?? through the ubiquitin-proteasome pathway. PR-39 stimulates angiogenesis in mice, inhibits inflammatory responses, and significantly reduces myocardial infarction size. Product Details…
Pramlintide is a polypeptide analogue of human amylin. Pramlintide, an antidiabetic agent, is antineoplastic in colorectal cancer. Product Information Product Name Pramlintide Molecular Weight 3949.39 Formula C171H267N51O53S2 CAS Number 151126-32-8 Appearance Solid Color White to off-white Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7) Sequence Shortening KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7) Storage Sealed storage, away from moisture Powder -80??C 2 years…
Pramlintide acetate is a polypeptide analogue of human amylin. Pramlintide acetate, an antidiabetic agent, is antineoplastic in colorectal cancer. Product Information Product Name Pramlintide acetate Molecular Weight 3949.39 (free base) Formula C171H267N51O53S2.xC2H4O2 CAS Number 187887-46-3 Appearance Solid Color White to off-white Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7) Sequence Shortening KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7) Storage Sealed storage, away from…
Pramlintide TFA is a polypeptide analogue of human amylin. Pramlintide TFA, an antidiabetic agent, is antineoplastic in colorectal cancer. Product Information Product Name Pramlintide TFA Molecular Weight 3949.39 (free base) Formula C171H267N51O53S2.xC2HF3O2 Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7) Sequence Shortening KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
Product Name Prepro VIP (81-122), human Biological activity Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus. CAS Number…
Product Name IGF-I (30-41) Biological activity IGF-I (30-41) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I). IGF-I is partly responsible for systemic GH activities although it possesses a wide number of own properties (anabolic, antioxidant, anti-inflammatory and cytoprotective actions). CAS Number 82177-09-1 Sequence Sequence Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr Sequence Shortening Sequence Shortening GYGSSSRRAPQT…
Product Name Biotinyl-α-CGRP (mouse, rat) Biological activity Biotinyl-α-CGRP (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
Product Name Thymosin β10Arg Biological activity Thymosin β10Arg is a thymosin β4-like peptide that contains an additional amino acid, arginine, inserted following lysine-38. Formula Formula C211H352N57O75S CAS Number 88160-82-1 Sequence Shortening Sequence Shortening Ac-ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Prokineticin 2 Isoform 2 (human) Biological activity Prokineticin 2 Isoform 2 (human) is a hypothalamic neuropeptide. Prokineticin 2 Isoform 2 (human) decreases food intake and involves in thermoregulation and energy metabolism in rodents. Prokineticin 2 has the potential for the research of hyperglycemia, metabolic syndrome (MetS) and obesity. CAS Number 423206-00-2 Sequence Sequence…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us