-GLP-1(7-37) acetate is a derivative of GLP-1 containing alanine-to-glycine substitution at positions 8. Product Information Product Name -GLP-1(7-37) acetate Molecular Weight 3341.64 (free base) Formula C150H226N40O47.xC2H4O2 Appearance Solid Color White to off-white Sequence His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Sequence Shortening HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6…
-Substance P TFA is a tachykinin NK1 receptor selective agonist. Product Information Product Name -Substance P TFA Molecular Weight 1507.68 Formula C66H101F3N18O17S CAS Number 2828433-10-7 Appearance Solid Color White to off-white Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-{Sar}-Leu-Met-NH2 Sequence Shortening RPKPQQFF-{Sar}-LM-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months;…
??-Defensin-4 human is an inducible peptide with a specific salt-sensitive antimicrobial activity profile. Product Details Product Name ??-Defensin-4 (human) Biological activity ??-Defensin-4 human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity. Sequence Glu-Leu-Asp-Arg-Ile-Cys-Gly-Tyr-Gly-Thr-Ala-Arg-Cys-Arg-Lys-Lys-Cys-Arg-Ser-Gln-Glu-Tyr-Arg-Ile-Gly-Arg-Cys-Pro-Asn-Thr-Tyr-Ala-Cys-Cys-Leu-Arg-Lys (disulfide bridge: Cys6-Cys33, Cys13-Cys27, Cys17-Cys34) Sequence Shortening ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK (disulfide bridge: Cys6-Cys33, Cys13-Cys27, Cys17-Cys34) Storage Please store the product…
??-defensin 1 (pig) (pBD-1) is an endogenous, constitutively expressed antimicrobial peptide (AMP) derived from porcine tissues, particularly expressed at porcine mucosal epithelial sites. ??-defensin 1 (pig) has antibacterial effects and contributes to porcine mucosal and systemic host defense. Product Details Product Name ??-defesin 1 (pig) Biological activity ??-defesin 1 (pig) (pBD-1) is an endogenous and…
Product Name ??-MSH Biological activity ??-MSH is a melanocortin peptide. ??-MSH is a weak melanocortin receptor (MCRs) ligand. CAS Number 100930-04-9 Sequence Sequence Ser-Met-Glu-Val-Arg-Gly-Trp Sequence Shortening Sequence Shortening SMEVRGW Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Big Endothelin-3 (22-41) amide (human) Biological activity Big Endothelin-3 (22-41) amide (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent…
Product Name Atrial Natriuretic Factor (5-27) (human) Biological activity Atrial Natriuretic Factor (5-27) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent…
Amount: 0.5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Other Purity: >90% (HPLC-MS) Quantification: No Sequence: H-ACGLSGLGVA-NH2 Specifications: 10mer cancer peptide
Angiotensin amide ((Asn1,Val5)-Angiotensin II) is a potent vasoconstrictor. Angiotensin amide is a derivative of angiotensin II. Angiotensin amide can be used as a cardiac activator. Product Information Product Name (Asn1,Val5)-Angiotensin II Molecular Weight 1031.17 Formula C49H70N14O11 CAS Number 53-73-6 Sequence Shortening NRVYVHPF Sequence Shortening NRVYVHPF
Product Name (Des-Glu5)-ACTH (1-24) (human, bovine, rat) Biological activity (Des-Glu5)-ACTH (1-24) (human, bovine, rat) is an analogue of Adrenocorticotropic hormone (ACTH; HY-106373). ACTH is a polypeptide tropic hormone produced by the anterior pituitary gland, regulating cortisol and androgen production. CAS Number 1815617-95-8 Sequence Sequence Ser-Tyr-Ser-Met-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro Sequence Shortening Sequence Shortening SYSMHFRWGKPVGKKRRPVKVYP Storage Please store the product…
Product Name (Cys(Acm)6,12)-Orexin A (human, mouse, rat) Biological activity (Cys(Acm)6,12)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent…
Product Name (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt9)-LHRH Biological activity (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 267878-61-5 Sequence Sequence…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
