Insert HTML here
Showing 3313–3328 of 3705 results
Protactin is a pentapeptide lactone that can be produced by the Streptomyces cucumerisporus strain L703-4 (ATCC 53784) and has significant antioxidant properties. Protactin can be converted to actinomycin Zp by ferricyanide oxidation. Actinomycin Zp exhibits potent antibacterial activity in vitro and has significant anti-tumor effects against P-388 leukemia in mouse models. Product Details Product Name…
Protegrin-1 is an orally active antimicrobial peptide. Protegrin-1 activates ERK, COX2, and NF??B, and inhibits apoptosis and NO production. Protegrin-1 has antibacterial activity against Staphylococcus aureus, Enterococcus faecium, Escherichia coli, Pseudomonas aeruginosa, and Klebsiella pneumoniae, with MBC values ranging from 10 to 20 ??M. Protegrin-1 has antiviral activity against dengue virus NS2B-NS3. Protegrin-1 has anti-inflammatory…
Protein Kinase C (beta) Peptide is a peptide fragment of Protein Kinase Cβ. Protein Kinase Cβ is related with hyperglycemia decreases endothelium-derived nitric oxide. Inhibition of Protein kinase Cβ prevents the reduction in endothelium-dependent vasodilation induced by acute hyperglycemia. Product Information Product Name Protein Kinase C β Peptide Molecular Weight 1966.18 Formula C84H136N22O30S CAS Number…
Protirelin is a highly conserved neuropeptide that exerts the hormonal control of thyroid-stimulating hormone (TSH) levels as well as neuromodulatory functions. Product Information Product Name Protirelin Molecular Weight 362.38
Product Name GLP-1 (7-36), amide, biotin labeled Biological activity GLP-1 (7-36), amide, biotin labeled (GLP-1 (7-36)-Lys (biotin)-amide) is a biotin-labeled truncated glucagon-like peptide-1 (GLP-1) incretin gut hormone. GLP-1 (7-36), amide, biotin labeled retains the core biological activities of GLP-1, including binding to its receptor (GLP-1R) and activating downstream signals (e.g., cAMP). Meanwhile, it can serve…
Protirelin Acetate is a highly conserved neuropeptide that exerts the hormonal control of thyroid-stimulating hormone (TSH) levels as well as neuromodulatory functions. Product Information Product Name Protirelin acetate Molecular Weight 452.46 Formula C16H22N6O4.3/2C2H4O2 CAS Number 120876-23-5 Appearance Solid Color White to off-white Sequence {pGlu}-His-Pro-NH2 Sequence Shortening {pGlu}-HP-NH2 Storage Sealed storage, away from moisture Powder -80??C…
Product Name Orexin B, rat, mouse Biological activity Orexin B, rat, mouse (Rat orexin B) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2, respectively. Molecular Weight 2936.4 Formula Formula C126H215N45O34S CAS Number 202801-92-1 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2 Sequence Shortening Sequence…
Pseudin-2 is an AMP that can be isolated from the skin of the South American paradoxical frog and has strong growth inhibitory effects against Gram-negative bacteria. Product Details Product Name Pseudin-2 Biological activity Pseudin-2, an AMP thast could be isolated from the skin of the South American paradoxical frog Pseudis paradoxa, exert a potent growth…
PSM-?? is an active peptide that can be isolated from Staphylococcus epidermidis. PSM-?? is an analog of staphylococcal toxins and a phenol-soluble modulin. PSM-?? has antibacterial activity and low hemolytic activity. Product Details Product Name PSM-?? Biological activity PSM-?? is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-?? is an analog…
Product Name Orexin B, human TFA Biological activity Orexin B, human (TFA) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2, respectively. Molecular Weight 3013.36 Formula Formula C123H212N44O35S.C2HF3O2 Appearance Solid Color White to off-white Sequence Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2 Sequence Shortening Sequence Shortening RSGPPGLQGRLQRLLQASGNHAAGILTM-NH2
Product Name Cortistatin-17 (human) Biological activity Cortistatin-17 (human) is a somatostatin neuropeptide with potential for studying diseases such as cancer, inflammation, autoimmunity, fibrosis, and pain. CAS Number 189450-19-9 Appearance Solid Color White to off-white Sequence Sequence Asp-Arg-Met-Pro-Cys-Arg-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Ser-Ser-Cys-Lys (Disulfide bridge: Cys5-Cys16) Sequence Shortening Sequence Shortening DRMPCRNFFWKTFSSCK (Disulfide bridge: Cys5-Cys16) Storage Sealed storage, away from moisture Powder…
Product Name δ-Sleep Inducing Peptide acetate Biological activity δ-Sleep Inducing Peptide acetate is a neuropeptide, with antioxidant and anxiolytic properties. Formula Formula C37H52N10O17 Appearance Solid Color White to off-white Sequence Sequence Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu Sequence Shortening Sequence Shortening WAGGDASGE Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In solvent :…
Product Name pTH (3-34) (bovine) Biological activity pTH (3-34) (bovine) is apTH ((Human parathyroid hormone) fragment. CAS Number 51257-86-4 Sequence Sequence Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe Sequence Shortening Sequence Shortening SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (Trp6)-LHRH Biological activity (Trp6)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 156126-74-8 Sequence Sequence…
Product Name (D-Leu6)-LHRH (1-8) Biological activity (D-Leu6)-LHRH (1-8) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 112642-14-5…
Product Name pTH (1-44) (human) Biological activity pTH (1-44) (human) is apTH ((Human parathyroid hormone) fragment. CAS Number 85568-24-7 Sequence Sequence Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg Sequence Shortening Sequence Shortening SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us