Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth. Product Information Product Name Vosoritide acetate Molecular Weight 4162.78 Formula C176H290N56O51S3.C2H4O2 Appearance Solid Color White to off-white Sequence Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39) Sequence Shortening PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39) Storage Sealed storage, away…
W(Dab)L is a cationic membrane-lytic antimicrobial peptide with protease stability, salt tolerance, and no induction of drug resistance. W(Dab)L is effective against planktonic MRSA, MRSA biofilms, and Pseudomonas aeruginosa, with relatively low cytotoxicity against mammalian cells. As a bactericidal agent, W(Dab)L selectively interacts with negatively charged bacterial membranes, causing membrane permeabilization, deformation, disintegration, leakage of…
WAY-181187 (SAX-187) oxalate is a potent and selective full 5-HT6 receptor agonist with a Ki of 2.2 nM and an EC50 of 6.6 nM. WAY-181187 oxalate mediates 5-HT6 receptor-dependent signal pathways, such as cAMP, Fyn and ERK1/2 kinase, as specific agonist. Product Information Product Name WAY-181187 oxalate Molecular Weight 470.91 Formula C17H15ClN4O6S2 CAS Number 1883548-85-3
WK2 is an antibacterial agent. WK2 reduces serum TNF-?? production induced by bacterial infection. WK2 reduces wound area and promotes tissue repair in a skin wound infection model. WK2 exhibits significant anti-inflammatory effects in a pneumonia model. WK2 can be used in research on infectious diseases such as bacterial pneumonia. Product Details Product Name WK2…
wkwkwNGwkwkw-NH2 is a self-assembling antimicrobial peptide with a ??-hairpin structure. wkwkwNGwkwkw-NH2 self-assembles to form nanofibers. wkwkwNGwkwkw-NH2 interacts with lipopolysaccharide (LPS) on the bacterial membrane surface, thereby disrupting the bacterial outer membrane, inner membrane, and cytoplasmic membrane to exert antibacterial effects. wkwkwNGwkwkw-NH2 has high antibacterial activity and low hemolytic activity. wkwkwNGwkwkw-NH2 significantly reduces the bacterial load…
WLBU2 is an engineered cationic antimicrobial peptide (eCAP) that overcomes the environmental susceptibility issues of natural antimicrobial peptides (AMPs). WLBU2 exhibits rapid bactericidal effects, with MIC values ?? 10 ??M against a variety of Gram-positive and Gram-negative bacteria (including methicillin-resistant Staphylococcus aureus, vancomycin-resistant Enterococcus, Klebsiella pneumoniae, Enterobacter aerogenes, Enterobacter cloacae, Escherichia coli, etc.). WLBU2 prevents…
wrwyar-NH2 (TFA) is a control peptide for wrwycr-NH2 (HY-P10930A). Product Information Product Name wrwyar-NH2 TFA Molecular Weight 936.07 (free base) Formula C46H61N15O7.xC2HF3O2 Appearance Solid Color White to off-white Sequence d{Trp-Arg-Trp-Tyr-Ala-Arg}-NH2 Sequence Shortening d{Trp-Arg-Trp-Tyr-Ala-Arg}-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month…
wrwycr-NH2 (TFA) is a peptide. wrwycr-NH2 (TFA) is cytotoxic to multiple cancer cells, can induce DNA damage and cell cycle arrest, but does not induce endoplasmic reticulum stress. wrwycr-NH2 (TFA) has anti-tumor activity, and it shows better efficacy when used in combination with DNA-damaging agents. Product Information Product Name wrwycr-NH2 TFA Molecular Weight 968.14 (free…
Product Name WWamide-3 Biological activity WWamide-3 is a neuropeptide, which can be isolated form Achatina fulica. WWamide-3 inhibits the rhythmic contraction of anterior byssus retractor muscle (ABRM). CAS Number 149636-89-5 Sequence Sequence Trp-Lys-Gln-Met-Ser-Val-Trp-NH2 Sequence Shortening Sequence Shortening WKQMSVW-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name WWamide-1 Biological activity WWamide-1 is a neuropeptide, which can be isolated form Achatina fulica. WWamide-1 inhibits central neurons of snails, regulates the snail muscle contraction. WWamide-1 inhibits the contraction of anterior byssus retractor muscle (ABRM), enhances the contraction of the radular traction muscle, through effects on presynaptic and postsynaptic membrane of the muscle….
Product Name [D-His26]-Neuropeptide Y, human, rat Biological activity -Neuropeptide Y, human, rat is a synthetic variant of neuropeptide Y (NPY). -Neuropeptide Y, human, rat acts as a Y1R agonist that can prevent the development of anxiety, social impairment, and depressive symptoms, and has the potential to be used as an early intervention treatment for post-traumatic…
Xaranetide is a polypeptide with neuroprotective effects. Product Information Product Name Xaranetide Molecular Weight 2829.36 Formula C108H218N72O19 CAS Number 3062244-70-3 Sequence d-{Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg} Sequence Shortening d-{RRRRRRRRRRRRRRRRRR}
Product Name Luteinizing Hormone Releasing Hormone (LH-RH), salmon Biological activity Luteinizing Hormone Releasing Hormone (LH-RH), salmon (Salmon GnRH) is the hypophysiotropic decapeptide synthesized in the hypothalamus that plays a crucial role in the control of reproductive functions. Formula Formula C60H73N15O13 CAS Number 86073-88-3 Appearance Solid Color White to off-white Sequence Sequence {Glp}-His-Trp-Ser-Tyr-Gly-Trp-Leu-Pro-Gly-NH2 Sequence Shortening Sequence…
Product Name Neuropeptide SF(mouse,rat) Biological activity Neuropeptide SF (mouse,rat) is a potent neuropeptide FF receptor agonist with Ki values are 48.4 nM and 12.1 nM for NPFF1 and NPFF2, respectively. Neuropeptide SF increases the amplitude of the sustained current of heterologously expressed acid sensing ion channel 3 (ASIC3) . Formula Formula C40H65N13O10 CAS Number 230960-31-3…
Product Name Neuromedin S(rat) TFA Biological activity Neuromedin S(rat) TFA is a 34-amino acids peptide from rat Neuromedin S. Neuromedin S is a neuropeptide isolated from rat brain. Neuromedin S acts as a ligand for the G protein-coupled receptor FM4/TGR-1 Appearance Solid Color White to off-white Sequence Sequence Leu-Pro-Arg-Leu-Leu-His-Thr-Asp-Ser-Arg-Met-Ala-Thr-Ile-Asp-Phe-Pro-Lys-Lys-Asp-Pro-Thr-Thr-Ser-Leu-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 Sequence Shortening Sequence Shortening LPRLLHTDSRMATIDFPKKDPTTSLGRPFFLFRPRN-NH2 Storage…
Xenopsin precursor fragment is an antimicrobial peptide with antibacterial/antifungal (MIC: 10-500 ??g/mL) and antiprotozoal (MIC: 2-20 ??g/mL) activities. Product Details Product Name Xenopsin precursor fragment Biological activity Xenopsin precursor fragment is an antimicrobial peptide, and has antibacterial/antifungal (10-500 ??g/mL) and anti-protozoal (MIC: 2-20 ??g/mL) activity. Sequence Gly-Trp-Ala-Ser-Lys-Ile-Gly-Gln-Thr-Leu-Gly-Lys-Ile-Ala-Lys-Val-Gly-Leu-Lys-Glu-Leu-Ile-Gln-Pro-Lys Sequence Shortening GWASKIGQTLGKIAKVGLKELIQPK Storage Please store the product…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
