Product Name Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea) Biological activity Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea) (PBAN), a member of the PBAN/Pyrokinin neuropeptide family, characterized by a common amino acid sequence FXPRLamide motif in the C-terminus. Formula Formula C167H259N47O57S2 CAS Number 122071-54-9 Sequence Sequence Leu-Ser-Asp-Asp-Met-Pro-Ala-Thr-Pro-Ala-Asp-Gln-Glu-Met-Tyr-Arg-Gln-Asp-Pro-Glu-Gln-Ile-Asp-Ser-Arg-Thr-Lys-Tyr-Phe-Ser-Pro-Arg-Leu-NH2 Sequence Shortening Sequence Shortening LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL-NH2 Storage…
Petrelintide (ZP8396) is a dual amylin and calcitonin receptor agonist (DACRA) Petrelintide elicits a selective reduction in high-fat diet intake in diet-induced obese (DIO) rats, which is accompanied by a loss of fat mass and preservation of lean mass during weight reduction. Petrelintide can be utilized in diabetes research. Product Information Product Name Petrelintide Molecular…
Perelintide (ZP8396) acetate is a dual amylin and calcitonin receptor agonist (DACRA). Perelintide acetate elicits a selective reduction in high-fat diet intake in diet-induced obese (DIO) rats, which is accompanied by a loss of fat mass and preservation of lean mass during weight reduction. Perelintide acetate can be utilized in diabetes research. Product Information Product…
Pexiganan (MSI 78) is an orally active antimicrobial peptide with broad-spectrum bactericidal activity. Pexiganan disrupts bacterial cell membranes, inducing peptidoglycan damage and cell lysis. Pexiganan TFA can be used in research on bacterial infections. Product Details Product Name Pexiganan Biological activity Pexiganan (MSI 78) is an orally active antimicrobial peptide with broad-spectrum bactericidal. Pexiganan disrupts…
Pexiganan (MSI 78) is an orally active antimicrobial peptide with broad-spectrum bactericidal. Pexiganan disrupts bacterial cell membranes, induces peptidoglycan damage and cell lysis. Pexiganan TFA can be used for the research of bacterial infection. Product Information Product Name Pexiganan Molecular Weight 2477.17 Formula C122H210N32O22 CAS Number 147664-63-9 Appearance Solid Color White to off-white Sequence Shortening…
Pexiganan (MSI 78) acetate is an orally active antimicrobial peptide with broad-spectrum bactericidal activity. Pexiganan acetate disrupts bacterial cell membranes, inducing peptidoglycan damage and cell lysis. Pexiganan TFA can be used in research on bacterial infections. Product Details Product Name Pexiganan acetate Biological activity Pexiganan (MSI 78) acetate is an orally active antimicrobial peptide with…
Pezadeftide is a potent antifungal peptide. Pezadeftide enters fungal cells and triggers a rapid mitochondrial response, leading to mitochondrial membrane hyperpolarization. Product Details Product Name Pezadeftide Biological activity Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane. Sequence Ala-Lys-Val-Cys-Thr-Lys-Pro-Ser-Lys-Phe-Phe-Lys-Gly-Leu-Cys-Gly-Thr-Asp-Gly-Ala-Cys-Thr-Thr-Ala-Cys-Arg-Lys-Glu-Gly-Leu-His-Ser-Gly-Tyr-Cys-Gln-Leu-Lys-Gly-Phe-Leu-Asn-Ser-Val-Cys-Val-Cys-Arg-Lys-His-Cys…
PGLa is an antimicrobial peptide containing 21 residues. PGLa is a member of the magainin family of antimicrobial peptides found in frog skin and its secretions. Product Details Product Name PGLa Biological activity PGLa, a 21-residue peptide, is an antimicrobial peptide. PGLa is a member of the magainin family of antibiotic peptides found in frog…
PGLa TFA is an antimicrobial peptide containing 21 residues. PGLa TFA is a member of the magainin family of antimicrobial peptides found in frog skin and its secretions. Product Details Product Name PGLa TFA Biological activity PGLa TFA, a 21-residue peptide, is an antimicrobial peptide. PGLa TFA is a member of the magainin family of…
PhD1 is an antimicrobial peptide derived from monkey blood leukocytes. PhD1 is active against bacteria and the fungus Candida albicans. Product Details Product Name PhD1 Biological activity PhD1 is an antimicrobial peptide derived from monkey white blood cells. PhD1 has activity against bacteria and fungus Candida albicans. Sequence Shortening RRICRCRIGRCLGLEVYFGVCFLHGRLARRCCR (Disulfide bridge:Cys4-Cys32,Cys6-Cys21,Cys11-Cys31) Storage Please store…
PhD2 is an antimicrobial peptide derived from monkey blood leukocytes. PhD2 is active against bacteria and the fungus Candida albicans. Product Details Product Name PhD2 Biological activity PhD2 is an antimicrobial peptide derived from monkey white blood cells. PhD2 has activity against bacteria and fungus Candida albicans. Sequence Shortening RICRCRIGRCLGLEVYFGVCFLHGRLARRCCR (Disulfide bridge:Cys3-Cys31, Cys5-Cys20, Cys10-Cys30) Storage…
PhD3 is an antimicrobial peptide derived from monkey blood leukocytes. PhD3 is active against bacteria and the fungus Candida albicans. Product Details Product Name PhD3 Biological activity PhD3 is an antimicrobial peptide derived from monkey white blood cells. PhD3 has activity against bacteria and fungus Candida albicans. Sequence Shortening RTCRCRLGRCSRRESYSGSCNINGRIYSLCCR (Disulfide bridge:Cys3-Cys31, Cys5-Cys20, Cys10-Cys30) Storage…
PhD4 is an antimicrobial peptide derived from monkey blood leukocytes. PhD4 is active against bacteria and the fungus Candida albicans. Product Details Product Name PhD4 Biological activity PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans. Sequence Shortening ACYCRIPACFAGERRYGTCFYLGRVWAFCC (Disulfide bridge:Cys2-Cys30, Cys4-Cys19,Cys9-Cys29) Storage Please…
Product Name Bradykinin (1-6) Biological activity Bradykinin (1-6) is an amino-truncated Bradykinin peptide. Bradykinin (1-6) is a stable metabolite of Bradykinin, cleaved by carboxypeptidase Y (CPY). Formula Formula C30H45N9O8 CAS Number 23815-88-5 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Pro-Gly-Phe-Ser Sequence Shortening Sequence Shortening RPPGFS Storage Sealed storage, away from moisture Powder -80??C 2…
Product Name Melanin Concentrating Hormone, salmon TFA Biological activity Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
