Insert HTML here
Showing 3297–3312 of 3705 results
PRO20 is a specific and competitive (pro)renin receptor (PRR) antagonist. PRO20 inhibits Prorenin-induced calcium influx with an IC50 value of 81 nmol/L. PRO20 exerts antihypertensive activity by blocking the binding of prorenin to the PRR, inhibiting the activation of the renin-angiotensin system (RAS), and reducing the production of angiotensin II (Ang II). PRO20 is promising…
Product Name pTH (1-84) (dog) Biological activity pTH (1-84) dog is a biologically active full-length canine parathyroid hormone, as well as an agonist of PTHR. pTH (1-84) dog can be detected by the “intact” PTH (W-PTH) assay, thus effectively distinguishing inactive C-terminal fragments. In terms of metabolic regulation, it rapidly and persistently stimulates hepatic glucose…
Product Name [Gln8]-C517 (LH-RH), chicken Biological activity -C517 (LH-RH), chicken is an avian hypothalamic peptide, which stimulates release of gonadotropins from anterior pituitary, thus regulating reproductive functions. CAS Number 47922-48-5 Appearance Solid Color White to off-white Sequence Sequence {pGLU}-His-Trp-Ser-Tyr-Gly-Leu-Gln-Pro-Gly Sequence Shortening Sequence Shortening {pGLU}-HWSYGLQPG Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C…
Product Name FGF acidic I (102-111) (bovine brain) Biological activity FGF acidic I (102-111) (bovine brain) (aFGF (102-111)) is the 102-111 fragment of acidic FGF that can be used as a potential neurotrophic agent. CAS Number 198542-00-6 Sequence Sequence His-Ala-Glu-Lys-His-Trp-Phe-Val-Gly-Leu Sequence Shortening Sequence Shortening HAEKHWFVGL Storage Please store the product under the recommended conditions in…
Product Name Angiotensin III, human, mouse Biological activity Angiotensin III, human, mouse is a heptapeptide, acts as an endogenous angiotensin type 2 receptor (AT2R) agonist, with IC50s of 0.648 nM and 21.1 nM for AT2R and AT1R, respectively. Molecular Weight 931.09 Formula Formula C46H66N12O9 CAS Number 13602-53-4 Appearance Solid Color White to off-white Sequence Sequence…
Product Name C-Peptide 2, rat Biological activity C-Peptide 2, rat, 31-amino-acid peptide, is a component of proinsulin. C-Peptide 2, rat can inhibit glucose-induced insulin secretion. CAS Number 41594-08-5 Sequence Shortening Sequence Shortening EVEDPQVAQLELGGGPGAGDLQTLALEVARQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa Biological activity Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa is a FMRF-like peptide from visceral and somatic muscles of the snail Helix aspersa. FMRF (Phe-Met-Arg-Phe) is a neuropeptide peptide consisting of 4 amino acid residues. CAS Number 98495-35-3 Appearance Solid Color White to off-white Sequence Sequence {pGLU}-Asp-Pro-Phe-Leu-Arg-Phe Sequence…
Proinsulin C-peptide (human) is a peptide consisting of 31 amino acids that links the A and B chains of proinsulin to ensure its correct folding. Proinsulin C-peptide (human) inhibits the high glucose-induced increase in PDGF-β receptor protein expression and the phosphorylation of p42/p44 MAP kinase. Proinsulin C-peptide (human) increases the deformability of erythrocytes derived from…
Product Name Human PTH-(1-31) Biological activity Human PTH-(1-31) is the 1-31 fragment of human PTH. Human PTH-(1-31) stimulates the release of cAMP and also is a weaker stimulator of the 25-hydroxyvitamin D-1α-hydroxylase. Human PTH-(1-31) induces bone formation without inducing bone resorption. Human PTH-(1-31) has the potential for the research of osteoporosis. CAS Number 157938-23-3 Sequence…
Product Name Osteogenic Growth Peptide, OGP Biological activity Osteogenic Growth Peptide, OGP is a short, naturally occurring 14-mer growth factor peptide found in serum at ??M concentrations. Formula Formula C68H110N22O18 CAS Number 132996-61-3 Appearance Solid Color White to off-white Sequence Sequence Ala-Leu-Lys-Arg-Gln-Gly-Arg-Thr-Leu-Tyr-Gly-Phe-Gly-Gly Sequence Shortening Sequence Shortening ALKRQGRTLYGFGG Storage Sealed storage, away from moisture Powder -80??C…
Product Name GnRH Associated Peptide (GAP) (1-13), human Biological activity GnRH Associated Peptide (GAP) (1-13), human is an amino acid peptide fragment derived from GnRH. GAP can increase the secretion of luteinizing hormone (LH) and follicle-stimulating hormone (FSH) in rat anterior pituitary cells. GAP also inhibit the secretion of prolactin. Formula Formula C65H101N15O25 CAS Number…
Product Name Urotensin I Biological activity Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively….
Product Name GLP-2 (1-34) (human) Biological activity GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human) can be used for the research of bone remodeling processes. CAS Number 99120-49-7 Sequence Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg Sequence Shortening Sequence Shortening HADGSFSDEMNTILDNLAARDFINWLIQTKITDR Storage Please store the product under the recommended conditions…
Product Name Prolactin-Releasing Peptide (12-31), bovine Biological activity Prolactin-Releasing Peptide (12-31), bovine is a peptide fragment of prolactin-releasing peptide (PrRP). PrRP is RF-amide peptides expressed in brain areas involved inpain modulation. Prolactin-Releasing Peptide (12-31), bovine can be used for the research of nervous system disease. CAS Number 209466-90-0 Sequence Sequence Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 Sequence Shortening Sequence Shortening…
Product Name PHI-27 (porcine) Biological activity PHI-27 (porcine) is a 27 amino acid peptide.PHI-27 (porcine) is used to find peptide hormones and other active peptides. CAS Number 80458-29-3 Sequence Shortening Sequence Shortening HADGVFTSDFSRLLGQLSAKKYLESLI-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Urotensin II, teleost fish Biological activity Urotensin II, teleost fish is a cyclic peptide. It can be isolated from the caudal neurosecretory system of?teleost?fish. Molecular Weight 1361.54 Formula Formula C62H84N14O17S2 CAS Number 9047-55-6 Sequence Shortening Sequence Shortening AGTADCFWKYCV(Disulfide bridge: Cys6-Cys11) Storage Please store the product under the recommended conditions in the Certificate of…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us