Insert HTML here
Showing 1105–1120 of 3705 results
CRAMP (mouse) is an antibacterial peptide and a functional homolog of LL-37. CRAMP (mouse) has potent antibacterial activity against Gram-negative bacteria. The complex formed by CRAMP (mouse) and CpG activates macrophages to secrete TNF-??. CRAMP (mouse) plays a key role in wound healing, immune regulation, and maintenance of intestinal homeostasis. Product Details Product Name CRAMP…
CRAMP-18 (mouse) is an antibiotic peptide with no hemolytic activity. CRAMP-18 (mouse) has good inhibitory activity against Gram-negative bacteria, such as S. typhimurium and P. aeruginosa. CRAMP-18 (mouse) has potential for research on antifungal, antibacterial, and anti-tumor activities. Product Details Product Name CRAMP-18 (mouse) Biological activity CRAMP-18 (mouse) is an antibiotic peptide without hemolytic activity….
CRAMP-18 (mouse) is an antibiotic peptide with no hemolytic activity. CRAMP-18 (mouse) has good inhibitory activity against Gram-negative bacteria, such as S. typhimurium and P. aeruginosa. CRAMP-18 (mouse) has potential for research on antifungal, antibacterial, and anti-tumor activities. Product Details Product Name CRAMP-18 (mouse) acetate Biological activity CRAMP-18 (mouse) acetate is an antibiotic peptide without…
Product Name Cerebellin Biological activity Cerebellin is a neuromodulatory hexadecapeptide that serves as a marker for Purkinje cell maturation. Cerebellin stimulates norepinephrine release via the adenylate cyclase/PKA-dependent signaling pathway. Cerebellin reduces insulin secretion from pancreatic islets under high-glucose conditions. Cerebellin also regulates synaptic structure formation and controls catecholamine secretion in peripheral tissues. Cerebellin can be…
Product Name Secretoneurin, rat Biological activity Secretoneurin, rat is a 33-amino acid neuropeptide produced by proteolytic processing of chromogranin II, widely distributed in the central and peripheral nervous systems, and its release is calcium-dependent. Secretoneurin, rat modulates the activities of caspase-3, caspase-1, the NLRP3 inflammasome, IGF-1R, VEGFR1, VEGFR2, FGFR3, AMPK, ERK1/2/MAPK, and Jak2/Stat3 pathways. Secretoneurin,…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Diarrhea, Hemorrhagic fever, Infection, Liver failure Layout: Freeze-dried in 2 glass vials Organism: Crimean-Congo hemorrhagic fever virus (CCHFV) Protein Name: Envelopment polyprotein Purity: Development Grade: each peptide purified…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Ebola fever, Infection Layout: Freeze-dried in glass vial Organism: Crimean-Congo hemorrhagic fever virus (CCHFV) Protein Name: Nucleoprotein Purity: >70% (HPLC-MS), Development Grade: each peptide…
Crotalicidin is an antimicrobial and anti-tumor peptide that effectively inhibits Gram-negative bacteria and tumor cell activity. Crotalicidin can be obtained from rattlesnake venom. Crotalicidin can be used in research on microbial infections and cancer. Product Details Product Name Crotalicidin Biological activity Crotalicidin is an antimicrobial peptide and anti-tumor peptide that can effectively inhibit the activity…
Crotamine is a Na+ channel modulator. Crotamine is a toxin composed of 42 amino acids cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and exhibits myonecrotic activity. Crotamine can be isolated from the venom of Crotalus durissus terrificus. Product Details Product Name Crotamine Biological activity Crotamine is a…
Product Name Ebiratide Biological activity Ebiratide (HOE-427 free base) is an ACTH 4-9 derivative, which acts directly on the central nervous system and exhibits memory-enhancing efficacy. Ebiratide enhances acetycholine (ACh) metabolism in rat brain. Formula Formula C48H73N11O10S CAS Number 105611-68-5 Sequence Sequence {Met(O2)}-Glu-His-Phe-{d-Lys}-{Phe-NH(CH2)8NH2} Sequence Shortening Sequence Shortening {Met(O2)}-EHF-{d-Lys}-{Phe-NH(CH2)8NH2} Storage Please store the product under the…
Product Name [His7] Corazonin Biological activity Corazonin, a neurohormone, induces dark color in the cuticle and epidermis of Locusta migratoria. CAS Number 138968-27-1 Sequence Shortening Sequence Shortening Glp-TFQYSHGWTN-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Substance P (7-11) Biological activity Substance P (7-11) is a C-terminal fragment of Substance P which can cause an increase in the intracellular calcium concentration. Formula Formula C31H44N6O5S CAS Number 51165-05-0 Appearance Solid Color White to off-white Sequence Sequence Phe-Phe-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening FFGLM-NH2 Storage Sealed storage, away from moisture and light…
CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research. Product Information Product Name CTCE-0214 Molecular Weight 3554.11 Formula C170H254N44O40 CAS Number 577782-52-6 Appearance Solid Color White to off-white Sequence Shortening KPVSLSYRAPFRFFGGGGLKWIQEYLEKALN-NH2 (Lactam:Lys20-Glu24) Sequence…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us