Insert HTML here
Showing 1153–1168 of 3705 results
Product Name AtPep3 TFA Biological activity AtPep3 TFA is a hormone-like peptide. AtPep3 TFA can enhance salinity tolerance of plants and inhibits the salt-induced bleaching of chlorophyll in seedlings. Formula Formula C102H178N36O32.xC2HF3O2 Sequence Shortening Sequence Shortening EIKARGKNKTKPTPSSGKGGKHN Storage Please store the product under the recommended conditions in the Certificate of Analysis.
D-K6L9 has antimicrobial and anti-biofilm activity against Pseudomonas aeruginosa (P. aeruginosa) from cystic fibrosis patients. D-K6L9 is stable, resistant to degradation by cystic fibrosis sputum proteases, and does not induce bacterial resistance. Product Details Product Name D-K6L9 Biological activity D-K6L9 shows antimicrobial and antibiofilm activities against P. aeruginosa from cystic fibrosis patients. D-K6L9 is stable…
d-KLA Peptide (D-(KLAKLAK)2), an isomer of KLA peptide (HY-P5345), is a pro-apoptotic peptide. d-KLA Peptide specifically targets mitochondria and induces apoptosis by disrupting the mitochondrial membrane. d-KLA Peptide increases caspase 3/7 activity, exerts a pro-apoptotic effect, and enhances anti-tumor efficacy in a mouse melanoma model. Product Details Product Name d-KLA Peptide Biological activity d-KLA Peptide…
Amount: 1 mg Application: Drug delivery Category: Cell-Penetrating Peptides Condition / Topic: Cancer, Gene therapy Layout: Freeze-dried in plastic vial Organism: Human immunodeficiency virus (HIV) Protein Name: CPP Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ygrkkrrqrrr-OH
d-WRL is a cationic antimicrobial peptide with salt tolerance, protease resistance, and no induction of drug resistance. d-WRL acts as a membrane-lytic agent that effectively kills planktonic MRSA, mature MRSA biofilms, and Pseudomonas aeruginosa. d-WRL selectively interacts with negatively charged bacterial membranes, causing changes in membrane permeability, structural disintegration, and leakage of intracellular contents, thereby…
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)
Product Name ORG-2766 Biological activity ORG-2766 is an adrenocorticotropic hormone ACTH 4-9 analog and neurotrophic peptide. ORG-2766 affects behavioral processes such as memory and attention in animals, improving symptoms in rats with experimental allergic neuritis. ORG-2766 has a neuroprotective effect. CAS Number 50913-82-1 Sequence Sequence {Met(O2)}-Glu-His-Phe-{d-Lys}-Phe Sequence Shortening Sequence Shortening {Met(O2)}-EHF-{d-Lys}-F Storage Please store the…
Product Name Boc-YPGFL(O-tBu) Biological activity Boc-YPGFL(O-tBu) is a selective δ opioid receptor (DOR) peptide antagonist. CAS Number 179124-36-8 Sequence Sequence Boc-Tyr-Pro-Gly-Phe-Leu-{Thr(OtBu)} Sequence Shortening Sequence Shortening Boc-YPGFL-{Thr(OtBu)} Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dalazatide (ShK-186) is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis, rheumatoid arthritis, type 1 diabetes and inflammatory bowel disease. Product Information Product Name Dalazatide Molecular Weight 4442.10 Formula C184H296N57O55PS7 CAS Number 1081110-69-1 Appearance Solid Color White to…
Dalazatide (ShK-186) TFA is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide TFA can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis, rheumatoid arthritis, type 1 diabetes and inflammatory bowel disease. Product Information Product Name Dalazatide TFA Molecular Weight 4442.10 (free acid) Formula C184H296N57O55PS7.xC2HF3O2 Appearance Solid Color…
Daptomycin is a lipopeptide antibiotic with rapid in vitro bactericidal activity against Gram-positive bacteria. Product Details Product Name Daptomycin Biological activity Daptomycin is a lipopeptide antibiotic with rapid in vitro bactericidal activity against gram-positive organisms. Molecular Weight 1620.67 Formula C72H101N17O26 CAS Number 103060-53-3 Appearance Solid Color Off-white to light yellow Sequence Dec-Trp-{d-Asn}-Asp-Thr-Gly-{Orn}-Asp-{d-Ala}-Asp-Gly-{d-Ser(Me)}-Glu-{Kynurenine} (Lactone: Thr4-Kynurenine13) Sequence…
Dasiglucagon is a human glucagon analog, and can increase plasma glucose. Dasiglucagon can be used in hypoglycemia research. Product Information Product Name Dasiglucagon Molecular Weight 3381.62 Formula C152H222N38O50 CAS Number 1544300-84-6 Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-{Aib}-Ala-Arg-Ala-Glu-Glu-Phe-Val-Lys-Trp-Leu-Glu-Ser-Thr Sequence Shortening HSQGTFTSDYSKYLD{Aib}ARAEEFVKWLEST
Dasiglucagon acetate is a human glucagon analog, and can increase plasma glucose. Dasiglucagon can be used in hypoglycemia research. Product Information Product Name Dasiglucagon acetate Molecular Weight 3441.67 Formula C154H226N38O52 Appearance Solid Color White to off-white Sequence Shortening HSQGTFTSDYSKYLD{Aib}ARAEEFVKWLEST (acetate) Sequence Shortening HSQGTFTSDYSKYLD{Aib}ARAEEFVKWLEST (acetate) Storage Sealed storage, away from moisture and light, under nitrogen Powder…
DD-S067 is an antibacterial peptide. DD-S067 has multiple antibacterial mechanisms, including disruption of the bacterial inner and outer membranes and induction of reactive oxygen species (ROS) production, leading to lipid peroxidation. DD-S067 also inhibits the electron transport chain. DD-S067 exhibits potent antibacterial activity, with a GM value of 4.1 ??M against 27 multidrug-resistant strains. DD-S067…
Decoralin is a short-chain cationic ??-helical antimicrobial peptide that can be isolated from the venom of the decorative potter wasp (Oreumenes decoratus). Decoralin exhibits rapid and selective antibacterial activity by disrupting bacterial cell membranes. Decoralin can be used in antimicrobial research. Product Details Product Name Decoralin Biological activity Decoralin is a short cationic alpha-helical antimicrobial…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us