CTCE-0214
Description
CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research.
Product Information
| Product Name | CTCE-0214 |
| Molecular Weight | 3554.11 |
| Formula | C170H254N44O40 |
| CAS Number | 577782-52-6 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Shortening KPVSLSYRAPFRFFGGGGLKWIQEYLEKALN-NH2 (Lactam:Lys20-Glu24) |
| Sequence Shortening | KPVSLSYRAPFRFFGGGGLKWIQEYLEKALN-NH2 (Lactam:Lys20-Glu24) |
| Storage | Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture and light) |
