CRAMP (mouse)
Description
CRAMP (mouse) is an antibacterial peptide and a functional homolog of LL-37. CRAMP (mouse) has potent antibacterial activity against Gram-negative bacteria. The complex formed by CRAMP (mouse) and CpG activates macrophages to secrete TNF-??. CRAMP (mouse) plays a key role in wound healing, immune regulation, and maintenance of intestinal homeostasis.
Product Details
| Product Name | CRAMP (mouse) |
| Biological activity | CRAMP (mouse) is an antibacterial peptide and a functional homolog of LL-37. CRAMP (mouse) exhibits potent antibacterial activity against Gram-negative bacteria. The complex formed by CRAMP (mouse) and CpG can activate macrophages to secrete TNF-??. CRAMP (mouse) plays a key role in wound healing, immune regulation and maintenance of intestinal homeostasis. |
| CAS Number | 376364-36-2 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln |
| Sequence Shortening | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Storage | Sealed storage, away from moisture |
