Insert HTML here
Showing 1073–1088 of 3705 results
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Cancer, Genital malignancies, Malignant genital cancers Layout: Freeze-dried in 7 glass vials, Freeze-dried in glass vial Organism: Human Papillomavirus (HPV) Protein Name: Selected…
Amount: 25 ug (approx. 15 nmol) / peptide for stimulation of 2,5 x 108 cells, 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Covid-19 Layout: Freeze-dried in 9 glass vials Organism: SARS-CoV-2 (Severe Acute Respiratory…
Amount: 25 ug (approx. 15 nmol) / peptide for stimulation of 2,5 x 108 cells, 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection, Severe acute respiratory syndrome (SARS) Layout: Freeze-dried in…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Covid-19 Layout: Freeze-dried in 20 glass vials Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name: Selected proteins Quantification: No Sequence: 20 different SARS-CoV-2 PepMixes:SARS-CoV-2…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Covid-19 Layout: Freeze-dried in 9 glass vials Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name: Selected proteins Quantification: No Sequence: 8 different SARS-CoV-2 PepMixes:SARS-CoV-2…
Colulintide (LY3541105) is an amylin-calcitonin dual receptor agonist with Amylin as its scaffold. Colulintide is applicable to research related to type 2 diabetes and obesity. Product Information Product Name Colulintide Molecular Weight 4191.73 Formula C188H309N45O62 CAS Number 2891912-36-8 Appearance Solid Color White to off-white Sequence Ac-Ala-Ser-His-Leu-Ser-Thr-Ala-Val-Leu-Gly-{Lys-AEEA-AEEA-gGlu-C20 diacid}-Leu-Ser-{Aib}-Glu-Leu-His-Lys-Leu-Glu-Asp-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Glu-Ser-Pro-NH2 Sequence Shortening Ac-ASHLSTAVLG-{Lys-AEEA-AEEA-gGlu-C20 diacid}-LS-{Aib}-ELHKLEDYPRTDVGAESP-NH2 Storage Sealed storage, away…
Combi-1 is an antimicrobial peptide with broad-spectrum activity against different bacteria and yeast cells. Product Details Product Name Combi-1 Biological activity Combi-1 is an antimicrobial peptide with broad-spectrum activity against different bacteria and yeast cells. Sequence Ac-Arg-Arg-Trp-Trp-Arg-Phe-NH2 Sequence Shortening Ac-RRWWRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Combi-2 is an antimicrobial peptide against S. aureus, S. sanguis, and E. coli. Product Details Product Name Combi-2 Biological activity Combi-2 is an antimicrobial peptide against S.aureus, S.sanguis and E.coli. Sequence Shortening Ac-FRWWHR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Amount: 5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Other Purity: >90% (HPLC-MS) Quantification: No Sequence: H-CGLSGLGVA-NH2 Specifications: 9mer cancer peptide
Copeptin (human) is a peptide biochemical reagent corresponding to the 39 amino acid sequence at the C-terminus of human pre-provasopressin, which serves as a stable surrogate biomarker reflecting the secretion of arginine vasopressin (AVP). Copeptin (human) can be used in studies related to AVP secretion, fluid and osmotic homeostasis, stress responses, and cardiovascular biomarkers. Product…
Product Name Endokinin C Biological activity Endokinin C is a peptide component of endokinin. Endokinin C works as a neurotransmitter or modulator in the pain system. Pretreatment with endokinin C prevents induction of scratching behavior and thermal hyperalgesia of endokinin A/B in mice. CAS Number 347837-74-5 Sequence Shortening Sequence Shortening KKAYQLEHTFQGLL Storage Please store the…
Corticostatin, human (Human Neutrophil Peptide-4) TFA is an antimicrobial peptide with antiviral activity. Corticostatin, human TFA can kill Escherichia coli, Streptococcus faecalis, and Candida albicans. Corticostatin, human (HNP-4) TFA has stronger bactericidal activity against Gram-negative bacteria than any of HNP-1-3. Corticostatin, human TFA can be isolated from the azurophilic granule fraction of a discontinuous Percoll…
Corticotropin-releasing factor human (Human CRF) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Product Information Product Name Corticotropin-releasing factor (human) Molecular Weight 4757.45 Formula C208H344N60O63S2 CAS Number 86784-80-7 Appearance Solid Color White to off-white Sequence Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 Sequence Shortening SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 Storage Sealed storage, away from moisture and light, under nitrogen Powder -80??C 2…
Product Name Neurokinin B Biological activity Neurokinin B is a tachykinin family peptide that preferentially binds to and activates NK3R over other tachykinin receptors. Neurokinin B preferentially binds to the substance P receptor (SP-N receptor) and mediates acetylcholine release from cholinergic neurons. Neurokinin B regulates the pulsatile release of Kisspeptin and GnRH, stimulates or inhibits…
Product Name Kisspeptin-54(human) Biological activity Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) inhibits tumor metastasis and stimulates the secretion of gonadotropin (LH) and testosterone. Molecular Weight 5857.43 Formula Formula C258H401N79O78 CAS Number…
Product Name Lysipressin Biological activity Lysipressin (Lysine vasopressin ; -Vasopressin ) is a neurohypophyseal nonapeptide with dual cardiovascular regulatory activities of peripheral pressor action and central hypotensive action, and it also regulates pain perception in the body. Lysipressin is an Oxytocin Receptor agonist, with a Ki value of 10.2 nM for porcine OT receptor. Lysipressin…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us