Insert HTML here
Showing 1121–1136 of 3705 results
Cyclic L27-11 is a peptidomimetic compound targeting the bacterial outer membrane protein LptD. Cyclic L27-11 has nanomolar antibacterial activity against Pseudomonas aeruginosa. Cyclic L27-11 binds to LptD and inhibits the transport of lipopolysaccharide to the cell surface. Cyclic L27-11 can be used in research related to Pseudomonas aeruginosa infections. Product Details Product Name Cyclic L27-11…
Product Name GLP-1(7-36), amide acetate Biological activity GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Molecular Weight 3297.64 (free base) Formula Formula C149H226N40O45.xC2H4O2 CAS Number 1119517-19-9 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Product Name Metamorphosin A Biological activity Metamorphosin A is a neuropeptide that can be isolated from Anthopleura elegantissima. Metamorphosin A triggers metamorphosis in Hydractinia echinata. CAS Number 157622-03-2 Sequence Sequence {Pyr}-Gln-Pro-Gly-Leu-Trp-NH2 Sequence Shortening Sequence Shortening {Pyr}-QPGLW-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Cyclic somatostatin (SRIF-14) acetate is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin acetate is a neuropeptide co-stored with acetylcholine in the cardiac parasympathetic innervation, exerts influences directly on contraction of ventricular cardiomyocytes. Cyclic somatostatin acetate inhibits the contractile response of isoprenaline with an IC50…
Product Name Acetyl neurotensin (8-13) Biological activity Acetyl neurotensin (8-13) is the shortest analog of neurotensin with full binding and pharmacological activities. CAS Number 74853-69-3 Sequence Sequence Arg-Arg-Pro-Tyr-Ile-Leu Sequence Shortening Sequence Shortening RRPYIL Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Cyclo(Arg-Pro) is a chitinase inhibitor. Cyclo(Arg-Pro) disrupts yeast cell separation and morphological transition by inhibiting chitinase activity. Cyclo(Arg-Pro) prevents cell separation of Saccharomyces cerevisiae, causing the formation of grape-like cell clusters without inhibiting cell growth. Cyclo(Arg-Pro) blocks the yeast-to-hyphal morphological transition of Candida albicans without inhibiting cell growth. Product Details Product Name Cyclo(Arg-Pro) Biological activity…
Cyclo(Arg-Pro) TFA is a chitinase inhibitor. Cyclo(Arg-Pro) TFA disrupts yeast cell separation and morphological transition by inhibiting chitinase activity. Cyclo(Arg-Pro) TFA prevents cell separation of Saccharomyces cerevisiae, causing the formation of grape-like cell clusters without inhibiting cell growth. Cyclo(Arg-Pro) TFA blocks the yeast-to-hyphal morphological transition of Candida albicans without inhibiting cell growth. Product Details Product…
Cyclo(L-leucyl-L-tryptophyl) (Cyclo(-Leu-Trp)) is a cyclic dipeptide that inhibits a variety of bacteria and fungi. Cyclo(L-leucyl-L-tryptophyl) is a melatonin receptor agonist and can also be used as a bitter-taste ligand. Product Details Product Name Cyclo(L-leucyl-L-tryptophyl) Biological activity Cyclo(L-leucyl-L-tryptophyl) (Cyclo(-Leu-Trp)) is a cyclic dipeptide that inhibits a various of bacteria and fungi. Cyclo(L-leucyl-L-tryptophyl) is a melatonin receptor…
Cyclo(L-Pro-L-Val) is an antibacterial and anti-inflammatory agent. Cyclo(L-Pro-L-Val) shows toxic activity against plant pathogenic microorganisms (such as R. fascians LMG 3605), with potency possibly comparable to that of chloramphenicol (HY-B0239). Cyclo(L-Pro-L-Val) inhibits the phosphorylation of IKK??, IKK??, and NF-??B, as well as the activation of iNOS and COX-2, thereby exerting anti-inflammatory activity. Cyclo(L-Pro-L-Val) can be…
Cyclo(L-Trp-L-Trp) is an antibiotic with antibacterial activity that inhibits A. baumannii, as well as Candida albicans, Bacillus subtilis, Micrococcus luteus, Saccharomyces cerevisiae, Aspergillus niger, and Staphylococcus aureus. Cyclo(L-Trp-L-Trp) can be used in research on microbial infections. Product Details Product Name Cyclo(L-Trp-L-Trp) Biological activity Cyclo(L-Trp-L-Trp) is an antibiotic, and shows antimicrobial activity. Cyclo(L-Trp-L-Trp) can inhibit A….
Cyclo(Leu-Ala) (Cyclo(alanine-leucine)) is a compound with antibacterial activity isolated from microorganisms, which together with other compounds has antibacterial activity against certain plant pathogens. Product Details Product Name Cyclo(Leu-Ala) Biological activity Cyclo(Leu-Ala) (Cyclo(alanine-leucine)) is an antimicrobial compound isolated from microorganisms and has antimicrobial activity against some plant pathogens together with other compounds. Appearance Solid Color White…
Cyclopetide 1 (Compound 1) is an antimicrobial peptide with moderate activity against Bacillus subtilis, with an MIC of 25 ??g/mL. Product Details Product Name Cyclopetide 1 Biological activity Cyclopetide 1 (Compound 1) is an antimicrobial peptide with moderate activity against B. subtilis, with a MIC of 25 ??g/mL. Sequence Cyclo(Gly-Ser-Pro-Glu) Sequence Shortening Cyclo(GSPE) Storage Please…
Cyclopetide 2 (Compound 2) is an antimicrobial peptide with moderate activity against Bacillus subtilis, with an MIC of 50 ??g/mL. Product Details Product Name Cyclopetide 2 Biological activity Cyclopetide 2 (Compound 2) is an antimicrobial peptide with moderate activity against B. subtilis, with a MIC of 50 ??g/mL. Sequence Cyclo(Gly-Pro-Glu) Sequence Shortening Cyclo(GPE) Storage Please…
Cyclosporin B is a group of nonpolar cyclic oligopeptides with immunosuppressive activity. Cyclosporin B is used for the prevention of graft rejection in organ transplantation. Product Information Product Name Cyclosporin B Molecular Weight 1188.58 Formula C61H109N11O12 CAS Number 63775-95-1 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture and light Powder -80??C…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Infectious mononucleosis Layout: Freeze-dried in glass vial Organism: Cynomolgus macaque cytomegalovirus (CyCMV), Rhesus Cytomegalovirus Protein Name: Glycoprotein Purity: >70% (HPLC-MS), Development Grade: each…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Infectious mononucleosis Layout: Freeze-dried in glass vial Organism: Cynomolgus macaque cytomegalovirus (CyCMV), Rhesus Cytomegalovirus Protein Name: Tegument protein Purity: >70% (HPLC-MS), Development Grade:…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us