Crotalicidin
Description
Crotalicidin is an antimicrobial and anti-tumor peptide that effectively inhibits Gram-negative bacteria and tumor cell activity. Crotalicidin can be obtained from rattlesnake venom. Crotalicidin can be used in research on microbial infections and cancer.
Product Details
| Product Name | Crotalicidin |
| Biological activity | Crotalicidin is an antimicrobial peptide and anti-tumor peptide that can effectively inhibit the activity of Gram-negative bacteria and tumor cells. Crotalicidin can be obtained from rattlesnake venom. Crotalicidin can be used in the study of microbial infections and cancer. |
| Sequence | Lys-Arg-Phe-Lys-Lys-Phe-Phe-Lys-Lys-Val-Lys-Lys-Ser-Val-Lys-Lys-Arg-Leu-Lys-Lys-Ile-Phe-Lys-Lys-Pro-Met-Val-Ile-Gly-Val-Thr-Ile-Pro-Phe-NH2 |
| Sequence Shortening | KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF-NH2 |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
