Insert HTML here
Showing 1057–1072 of 3705 results
Cn-AMP1 is a disulfide-free plant peptide that can be isolated from green coconut water. Cn-AMP1 is active against a variety of pathogenic bacteria, fungi, and cancer cells. Cn-AMP1 upregulates the secretion of inflammatory cytokines by monocytes. Cn-AMP1 can be used in research on controlling bacterial infections and cancer. Product Details Product Name Cn-AMP1 Biological activity…
Product Name Glucagon-like peptide 1 (1-37), human TFA Biological activity Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor. Molecular Weight 4169.48 (free acid) Formula Formula C186H275N51O59.xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Sequence Shortening Sequence Shortening HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
cOB1 pheromone, a bacterial pheromone, effectively inhibits the multidrug-resistant Enterococcus faecalis V583. Product Details Product Name cOB1 phermone Biological activity cOB1 phermone, a bacterial sex pheromone, effectively inhibits multidrug-resistant Enterococcus faecalis V583. Sequence Val-Ala-Val-Leu-Val-Leu-Gly-Ala Sequence Shortening VAVLVLGA Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Coccinin is an antifungal peptide. Coccinin can be purified from the seeds of the scarlet runner bean. Coccinin inhibits HIV-1 reverse transcriptase. Coccinin exhibits antifungal activity against M. arachidicola, F. oxysporum, P. piricola, B. cinerea, C. comatus, and R. solani, with IC50 values of 75, 81, 89, 109, 122, and 134 ??M, respectively. Product Details…
Product Name Small cardioactive peptide A Biological activity Small cardioactive peptide A (SCPA) is a neuropeptide that can be obtained from Aplysia. CAS Number 98035-79-1 Sequence Shortening Sequence Shortening ARPGYLAFPRM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name LH-RH II (chicken) Biological activity LH-RH II (chicken) is one of the two forms of luteinizing hormone-releasing hormone (LHRH) the hypothalamus of the domestic hen, which are structural variants of mammalian LHRH. LH-RH II (chicken) enhances gonadotrophin release in the domestic chicken. Molecular Weight 1236.3 Formula Formula C60H69N17O13 CAS Number 91097-16-4 Sequence Shortening…
Codactide is a synthetic octadecapeptide, with corticotropin-like action. Product Information Product Name Codactide Molecular Weight 2192.59 Formula C101H158N30O23S CAS Number 22572-04-9 Sequence {d-Ser}-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Lys-Lys-NH2 Sequence Shortening {d-Ser}-YSMEHFRWGKPVGKKKK-NH2
Colistin A sulfate hydrate is a major component of Colistin. Colistin is a polymyxin antibiotic. Colistin can be used against infections caused by Gram-negative bacteria. Product Details Product Name Colistin A sulfate hydrate Biological activity Colistin A sulfate hydrate is a major component of Colistin. Colistin is a polymyxin antibiotic and can be used to…
Colistin B (Polymyxin E2) sulfate is a major component of colistin (HY-113678) and is also an antibacterial agent active against multidrug-resistant Gram-negative bacteria. Colistin B sulfate has an apoptotic effect on human renal proximal tubule cells. Colistin B sulfate can induce mild to moderate renal histological damage in mouse models. Colistin B sulfate can be…
Amount: 2 x aliquots of each peptide pool (1??g /peptide /pool), 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Infection, Merkel cell carcinoma, Nephritis, interstitial, Opportunistic infections Layout: 1-sample peptide microarray, Freeze-dried in 6 glass vials Organism:…
Amount: 2 x aliquots of each peptide pool (1??g /peptide /pool) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Infection, Merkel cell carcinoma, Nephritis, interstitial, Opportunistic infections Layout: Freeze-dried in 1 x 96 tube rack Organism: BK Polyomavirus (BKV) Protein Name: Selected proteins Purity: Development Grade: each peptide purified to > 70% (HPLC/MS)…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Cancer, Genital malignancies, Malignant genital cancers Layout: Freeze-dried in 7 glass vials, Freeze-dried in glass vial Organism: Human Papillomavirus (HPV) Protein Name: Protein E6 Purity: >70%…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Cancer, Genital malignancies, Malignant genital cancers Layout: Freeze-dried in 7 glass vials, Freeze-dried in glass vial Organism: Human Papillomavirus (HPV) Protein Name: Protein E7 Purity: >70%…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Control, Cytomegalovirus disease, Infectious mononucleosis, Opportunistic infections Layout: Freeze-dried in 20 glass vials, Freeze-dried in glass vial Organism: Human Cytomegalovirus (HCMV) Protein Name: Selected proteins Purity:…
Amount: 2 x aliquots of each peptide pool (1μg /peptide /pool) Application: T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Cancer, Control, Cytomegalovirus disease, Infectious mononucleosis, Opportunistic infections Layout: Freeze-dried in 1 x 96 tube rack Organism: Human Cytomegalovirus (HCMV) Protein Name: Selected proteins Purity: >70% (HPLC-MS), Development Grade: each peptide purified…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Collections, PepMix Peptide Pools Condition / Topic: Cancer, Melanoma Layout: Freeze-dried in 9 glass vials, Freeze-dried in glass vial Organism: Human Protein Name: Selected proteins Purity: >70% (HPLC-MS), Development Grade:…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us