Insert HTML here
Showing 3553–3568 of 3705 results
Temporin K is an antimicrobial peptide against Legionella pneumophila. Product Details Product Name Temporin K Biological activity Temporin K is an antimicrobial peptide against Legionella pneumophila. Sequence Leu-Leu-Pro-Asn-Leu-Leu-Lys-Ser-Leu-Leu-NH2 Sequence Shortening LLPNLLKSLL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Temporin L is a potent antimicrobial peptide active against Gram-negative bacteria and yeast strains. Temporin L also has anti-endotoxin properties. Product Details Product Name Temporin L Biological activity Temporin L is a potent antimicrobial peptide and is active against Gram-negative bacteria and yeast strains. Temporin L also has antiendotoxin properties. Appearance Solid Color White to…
Temporin SHF is a broad-spectrum antimicrobial peptide active against Gram-positive bacteria, Gram-negative bacteria, and yeast, without hemolytic activity. Temporin SHF disrupts the acyl chain packing of anionic lipid bilayers, leading to fissures and microbial membrane disintegration. Temporin SHF can be used in the development of antibacterial drugs. Product Details Product Name Temporin SHF Biological activity…
Temporin-GHc has antibacterial activity with an MBIC50 value of 6 ??M and anti-biofilm activity with an MBEC50 value of 25 ??M at 24 hours. Product Details Product Name Temporin-GHc Biological activity Temporin-GHc has an antibacterial activity with MBIC50 value of 6 ??M and antibiofilm activity with MBEC50 value of 25 ??M at 24 h. Sequence…
Temporin-GHd has antibacterial activity against Streptococcus mutans (MIC=13.1 ??M; MBC=26 ??M). Temporin-GHd increases the permeability of the bacterial cell membrane, leading to membrane damage and leakage of cellular contents. Temporin-GHd disrupts preformed biofilms at high concentrations. Temporin-GHd can bind to bacterial DNA and inhibit DNA migration. Product Details Product Name Temporin-GHd Biological activity Temporin-GHd exhibits…
Temporin-SHa is an antimicrobial peptide with broad biological activities. Temporin-SHa is effective against Gram-positive bacteria (such as Listeria, MIC = 6.25 ??M), Gram-negative bacteria (such as E. coli, MIC = 10 ??M), and drug-resistant strains (such as methicillin-resistant Staphylococcus aureus). Temporin-SHa also has inhibitory effects against Candida albicans (MIC = 25 ??M), Saccharomyces cerevisiae (MIC…
Product Name Oxytocin Biological activity Oxytocin (α-Hypophamine; Oxytocic hormone) is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma. Molecular Weight 1007.19 Formula Formula C43H66N12O12S2 CAS Number 50-56-6 Appearance Solid Color…
Teriparatide (Human parathyroid hormone-(1-34)) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research. Product Information Product Name Teriparatide Molecular Weight 4117.72 Formula C181H291N55O51S2 CAS Number 52232-67-4 Appearance Solid Color White to off-white Sequence Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe Sequence Shortening SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Storage Sealed storage, away from moisture and light Powder -80??C 2 years…
Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research. Product…
Terlipressin diacetate is a vasopressin analogue with potent vasoactive properties. Terlipressin diacetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin diacetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin diacetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research. Product…
Termicin is an antimicrobial peptide derived from Pseudacanthotermes spiniger. Termicin has activity against Gram-positive bacteria, filamentous fungi, and yeast. Product Details Product Name Termicin Biological activity Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity. Sequence Shortening ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG-NH2 (Disulfide bridge:C1-C4,C2-C5,C3-C6) Storage Please store the product under the…
Tet-20 is a biologically active peptide (Tet-20 is a synthetic cathelicidin-derived peptide. It has been tested as an anti-infective coating for medical devices. When tethered to implant surfaces, Tet-20 exhibits broad-spectrum antibacterial activity both in vivo and in vitro. It prevents biofilm formation and is non-toxic to eukaryotic cells). Product Details Product Name Tet-20 Biological…
Tet-213 is an antimicrobial peptide. Tet-213 has broad-spectrum antibacterial activity. Tet-213 promotes the repair of infected wounds. Product Details Product Name Tet-213 Biological activity Tet-213 is a antimicrobial peptide. Tet-213 has broad spectrum antibacterial activity. Tet-213 can promote infected wound repair. CAS Number 1260528-09-3 Sequence Shortening KRWWKWWRRC Storage Please store the product under the recommended…
Tet-213 TFA is an antimicrobial peptide. Tet-213 TFA has broad-spectrum antibacterial activity. Tet-213 TFA promotes the repair of infected wounds. Product Details Product Name Tet-213 TFA Biological activity Tet-213 TFA is a antimicrobial peptide. Tet-213 TFA has broad spectrum antibacterial activity. Tet-213 TFA can promote infected wound repair. Appearance Solid Color White to off-white Sequence…
Tetracosactide (Tetracosactrin) is an analogue of adrenocorticotrophic hormone (ACTH). Tetracosactide is the agonist for melanocortin-4 receptor (MC4R) that activates human MC4R with an EC50 of 0.65 nM. Tetracosactide can stimulate the release of corticosteroids such as cortisol from the adrenal gland. Tetracosactide is currently used for the research of ulcerative colitis and Crohn’s disease, juvenile/adult…
Tetracosactide acetate (Tetracosactrin acetate ) is the acetate salt form of Tetracosactide (HY-P0060). Tetracosactide acetate is an analogue of adrenocorticotrophic hormone (ACTH). Tetracosactide acetate is the agonist for melanocortin-4 receptor (MC4R) that activates human MC4R with an EC50 of 0.65 nM. Tetracosactide acetate can stimulate the release of corticosteroids such as cortisol from the adrenal…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us