Insert HTML here
Showing 3505–3520 of 3705 results
Product Name Substance P (3-11) Biological activity Substance P (3-11) is a substance P (SP) fragment peptide that can cross the BBB. Substance P (3-11) has contracting activities on guinea pig ileum. Substance P (3-11) also promotes human monocyte chemotaxis . Molecular Weight 1094.33 Formula Formula C52H79N13O11S CAS Number 51165-11-8 Sequence Sequence Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 Sequence Shortening…
Product Name [Tyr0,D-Trp8] Somatostatin Biological activity Somatostatin is the analog of Somatostatin. CAS Number 99341-94-3 Sequence Shortening Sequence Shortening YAGCKNFF-{D-Trp}-KTFTSC (disulfide bridge:Cys4-Cys15) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Substance P (2-11) Biological activity Substance P (2-11) is a substance P (SP) fragment peptide. Substance P (2-11) has contracting activities on guinea pig ileum. Substance P (2-11) inhibits the permeation of 3H SP in BBMEC monolayers. Formula Formula C57H86N14O12S CAS Number 53749-61-4 Sequence Shortening Sequence Shortening PKPQQFFGLM-NH2 Storage Please store the product…
Product Name [D-Trp8,Tyr11] Somatostatin Biological activity Somatostatin is an analogue of somatostatin. Somatostatin is a hormone that regulates a variety of bodily functions. DTrp8 residue can increase stability. CAS Number 75176-06-6 Sequence Shortening Sequence Shortening AGCKNFF-{D-Trp}-KTYTSC (disulfide bridge:Cys3-Cys14) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neuromedin C (porcine) Biological activity Neuromedin C porcine (GRP, 18-27, porcine) is a bombesin-like neuropeptide that can be obtained from porcine spinal cord. Neuromedin C porcine exhibits a potent contractile activity on rat uterus in the characteristic manner of bombesin. Neuromedin C porcine has research potential for neurological-related diseases. CAS Number 81608-30-2 Appearance…
Product Name Substance P (4-11) Biological activity Substance P (4-11), the C-terminus fragment of Substance P (HY-P0201), is a Substance P agonist that shows highly selective for NK1 receptors. Formula Formula C46H67N11O10S CAS Number 53749-60-3 Sequence Shortening Sequence Shortening PQQFFGLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Melanin Concentrating Hormone, salmon Biological activity Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2. Molecular Weight 2099.48 Formula…
Product Name MLGFFQQPKPR-NH2 Biological activity MLGFFQQPKPR-NH2 is a reversed Substance P peptide. Substance P is a neuropeptide. CAS Number 1802883-75-5 Sequence Shortening Sequence Shortening MLGFFQQPKPR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neuropeptide Y (3-36) (human, rat) Biological activity Neuropeptide Y (3-36) (human, rat) is a neuropeptide Y fragment derived from humans or rats. Neuropeptide Y is an extremely abundant neurotransmitter in central and peripheral neurons, and it participates in the regulation of psychomotor activity, circadian rhythm, feeding behavior and cardiovascular function. Neuropeptide Y (3-36)…
Product Name [Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2 Biological activity -PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) is a synthetic PACAP 1-27 (HY-P0176) analogue with relaxant effect. Formula Formula C157H253N53O42 CAS Number 176785-25-4 Sequence Shortening Sequence Shortening HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name PEN (rat) TFA Biological activity PEN (rat) TFA, one of the most abundant hypothalamic neuropeptide and derived from the proprotein ProSAAS, is an endogenous ligand of GPR83. Formula Formula C104H170F3N27O35.xC2HF3O2 Sequence Sequence Ala-Val-Asp-Gln-Asp-Leu-Gly-Pro-Glu-Val-Pro-Pro-Glu-Asn-Val-Leu-Gly-Ala-Leu-Leu-Arg-Val Sequence Shortening Sequence Shortening AVDQDLGPEVPPENVLGALLRV Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Angiotensin II (3-8), human Biological activity Angiotensin II (3-8), human is a less effective agonist at the angiotensin AT1 receptor. Molecular Weight 774.91 Formula Formula C40H54N8O8 CAS Number 12676-15-2 Sequence Sequence Val-Tyr-Ile-His-Pro-Phe Sequence Shortening Sequence Shortening VYIHPF Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Calcitonin, eel Biological activity Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis. Formula Formula C146H241N43O47S2 CAS Number 57014-02-5 Sequence Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) Sequence Shortening Sequence Shortening CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7) Storage Please store the product under…
Product Name β-Melanocyte Stimulating Hormone (MSH), human TFA Biological activity β-Melanocyte Stimulating Hormone (MSH), human TFA, a 22-residue peptide, acts as an endogenous melanocortin-4 receptor (MC4-R) agonist. Molecular Weight 2774.94 Formula Formula C120H175F3N34O37S Appearance Solid Color White to off-white Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In…
Sucantomotide is an immunological agent for active immunization (antineoplastic). Product Information Product Name Sucantomotide Molecular Weight 1097.37 Formula C54H84N10O12S CAS Number 2378651-62-6 Sequence Phe-Met-Leu-Gly-Glu-Phe-Leu-Lys-Leu Sequence Shortening FMLGEFLKL
Suicin 65 is a type B antibiotic produced from Streptococcus suis and is active against all Streptococcus suis strains. Product Details Product Name Suicin 65 Biological activity Suicin 65 is a class I type B lantibiotic produced by Streptococcus suis. Suicin 65 is active against all S. suis isolates. Sequence Shortening GKNGVFK-{Abu}-IAHEAHMNAWQFLF-{Dhb}-AAS Storage Please store…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us