Termicin
Description
Termicin is an antimicrobial peptide derived from Pseudacanthotermes spiniger. Termicin has activity against Gram-positive bacteria, filamentous fungi, and yeast.
Product Details
| Product Name | Termicin |
| Biological activity | Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity. |
| Sequence Shortening | ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG-NH2 (Disulfide bridge:C1-C4,C2-C5,C3-C6) |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
