Insert HTML here
Showing 3601–3616 of 3705 results
Product Name [Phe2]-TRH Biological activity -TRH is a thyrotropin releasing hormone analogue, equipping a conformational similarity with Leu5-enkephalin. Formula Formula C19H24N4O4 CAS Number 34783-35-2 Sequence Shortening Sequence Shortening Glp-FP-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Tritrpticin is a porcine antimicrobial peptide with membrane disruption and hemolytic properties. Tritrpticin disrupts the membranes of bacteria, fungi, and Jurkat T-cell leukemia cells and induces their death. Tritrpticin also enhances the efficacy of Metronidazole (HY-B0318) against Trichomonas vaginalis, reduces plasma endotoxin and inflammatory cytokine levels, limits bacterial growth in blood and visceral tissues, reduces…
Trofinetide (NNZ-2566), a synthetic analogue of the endogenous N-terminus tripeptide, Glycine-Proline-Glutamate (GPE), has been shown to be neuroprotective in animal models of brain injury. Product Information Product Name Trofinetide Molecular Weight 315.32 Formula C13H21N3O6 CAS Number 853400-76-7 Appearance Solid Color White to off-white Sequence Gly-{Pro(α-Me)}-Glu Sequence Shortening G{Pro(α-Me)}E Storage Sealed storage, away from moisture and…
TRV120027, a β-arrestin-1-biased agonist of the angiotensin II receptor type 1 (AT1R), engages β-arrestins while blocking G-protein signaling. TRV120027 induces acute catecholamine secretion through cation channel subfamily C3 (TRPC3) coupling, promotes the formation of a macromolecular complex composed of AT1R-β-arrestin-1-TRPC3-PLCγ at the plasma membrane. TRV120027 inhibits angiotensin II-mediated vasoconstriction and increases cardiomyocyte contractility. TRV120027 has…
TRV120027 TFA, a β-arrestin-1-biased agonist of the angiotensin II receptor type 1 (AT1R), engages ?-arrestins while blocking G-protein signaling. TRV120027?TFA induces?acute?catecholamine?secretion?through cation channel subfamily C3 (TRPC3) coupling, promotes the formation of a macromolecular complex composed of AT1R?Cβ-arrestin-1?CTRPC3?CPLCγ at the plasma membrane. TRV120027 TFA inhibits angiotensin II?Cmediated vasoconstriction and increases cardiomyocyte contractility. TRV120027 TFA has the…
TT-232 (CAP-232), a somatostatin derivative, is a peptide SSTR1/SSTR4 agonist. TT-232 inhibits cancer cell proliferation and induces apoptosis. TT-232 is also a broad-spectrum anti-inflammatory and analgesic agent. Product Information Product Name TT-232 Molecular Weight 947.13 Formula C45H58N10O9S2 CAS Number 147159-51-1 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture and light, under…
Product Name pTH (1-37) (human) Biological activity PTH (1-37) human is an adenylate cyclase stimulator and a normocalcemic regulator. PTH (1-37) human participates in cAMP-dependent signal transduction to affect the proliferation of skeletal tissue cells and bone metabolism. PTH (1-37) human induces cyclic adenosine monophosphate responses in human primary osteoblast-like cells and is also widely…
Tur1A is an antimicrobial peptide derived from the bottlenose dolphin. Tur1A inhibits bacterial protein synthesis by binding to the ribosome and blocking the transition from the initiation phase to the elongation phase. Product Details Product Name Tur1A Biological activity Tur1A is an antimicrobial peptide derived from bottlenose dolphins Tursiops truncates. Tur1A inhibits bacterial protein synthesis…
Product Name Angiotensin I/II (1-5) Biological activity Angiotensin I/II 1-5 is a peptide that contains the amino acids 1-5, which is converted from Angiotensin I/II. Angiotensin I is formed by the action of renin on angiotensinogen. Angiotensin II is produced from angiotensin I. Angiotensin II has been investigated for the treatment, basic science, and diagnostic…
Product Name α-Synuclein (71-82) (human) Biological activity α-Synuclein (71-82) (human) is the 71-82 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a biomarker for Parkinson’s disease (PD). Formula Formula C51H91N13O17 CAS Number 332867-16-0 Sequence Sequence Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val Sequence Shortening Sequence Shortening VTGVTAVAQKTV Storage Please store…
Product Name [Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 Biological activity VIP-Gly-Lys-Arg-NH2 is a vasoactive intestinal polypeptide (VIP) analog with relaxant effects. Formula Formula C162H267N57O45 CAS Number 186844-13-3 Sequence Shortening Sequence Shortening HSDAVFTDNYTRLRRQLAVRRYLNSILNGKR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Endokinin D Biological activity Endokinin D is a human tachykinin and consist of 14 amino acid residues. CAS Number 566151-48-2 Sequence Shortening Sequence Shortening VGAYQLEHTFQGLL Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Biotinyl-Somatostatin-14 Biological activity Biotinyl-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 145251-83-8 Sequence Sequence…
Product Name Lumekefamide Biological activity Lumekefamide (Dermorphin-(1-4) amide) is a N-terminal shorter peptide amide of dermorphin with the hypothermic effect. Lumekefamide shows analgesic activity and degradation in soluble mouse liver and brain extracts. CAS Number 100304-60-7 Sequence Sequence Tyr-(D-Arg)-Phe-Gly-NH2 Sequence Shortening Sequence Shortening Y-{D-Arg}-FG-NH2 Storage Please store the product under the recommended conditions in the…
Product Name Tyr0-Neurokinin A Biological activity Tyr0-Neurokinin A is a neuropeptide belongs to tachykinin peptide family. Tyr0-Neurokinin A is an agonist of Tacr2. Tyr0-Neurokinin A can be used in the research of insulin resistance, obesity, diabetes. Formula Formula C59H89N15O16S CAS Number 116868-93-0 Sequence Shortening Sequence Shortening YHKTDSFVGLM-NH2 Storage Please store the product under the recommended…
Tyrosylleucine (Tyr-Leu, YL), an orally active dipeptide, exhibits a potent antidepressant-like activity. Product Information Product Name Tyrosylleucine Molecular Weight 294.35 Formula C15H22N2O4 CAS Number 17355-10-1 Appearance Solid Color White to off-white Sequence Tyr-Leu Sequence Shortening YL Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months;…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us