Pyrrhocoricin is a biologically active peptide (with antibacterial activity against Gram-negative bacteria). Product Details Product Name Pyrrhocoricin Biological activity Pyrrhocoricin is a biological active peptide. (Antimicrobial activity against Gram-negative bacteria) Sequence Val-Asp-Lys-Gly-Ser-Tyr-Leu-Pro-Arg-Pro-{O-[2-(acetylamino)-2-deoxy-3-O-??-D-galactopyranosyl-??-D-galactopyranosyl]-Thr}-Pro-Pro-Arg-Pro-Ile-Tyr-Asn-Arg-Asn-NH2 Sequence Shortening VDKGSYLPRPXPPRPIYNRN-NH2 (X=O-[2-(acetylamino)-2-deoxy-3-O-??-D-galactopyranosyl-??-D-galactopyranosyl]-Thr) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Quinupristin is a streptogramin antibiotic. Quinupristin blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits . Product Information Product Name Quinupristin Molecular Weight 1022.22 Formula C53H67N9O10S CAS Number 120138-50-3 Appearance Solid Color White to off-white Sequence Shortening T-Abu-PF-Pip-Phg (Lactone:Thr1-Phg6) Sequence…
Quinupristin is a streptogramin antibiotic. Quinupristin blocks the synthesis of peptide bonds in bacterial ribosomal subunits, prevents the elongation of polypeptide chains, and promotes the dissociation of incomplete protein chains. Product Details Product Name Quinupristin Biological activity Quinupristin is a streptogramin antibiotic. Quinupristin blocks peptide bond synthesis to prevent the extension of polypeptide chains and…
Quinupristin mesylate is a streptogramin antibiotic. Quinupristin mesylate blocks the synthesis of peptide bonds in bacterial ribosomal subunits, prevents the elongation of polypeptide chains, and promotes the dissociation of incomplete protein chains. Product Details Product Name Quinupristin mesylate Biological activity Quinupristin mesylate is a streptogramin antibiotic. Quinupristin mesylate blocks peptide bond synthesis to prevent the…
Quinupristin mesylate is a streptogramin antibiotic. Quinupristin mesylate blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits. Product Information Product Name Quinupristin mesylate Molecular Weight 1118.32 Formula C54H71N9O13S2 Sequence Shortening T-Abu-PF-Pip-Phg (Lactone:Thr1-Phg6) Sequence Shortening T-Abu-PF-Pip-Phg (Lactone:Thr1-Phg6)
R2R01 is a potent and selective agonist of the relaxin family peptide receptor 1 (RXFP1), with an EC50 value of 0.34 nM. R2R01 activates RXFP1 to induce relaxin-like biological responses. R2R01 increases heart rate in both denervated and conscious rats. R2R01 can be used in research on cardiovascular diseases. Product Details Product Name R2R01 Biological…
R2R01 is a potent and selective relaxin family peptide receptor 1 (RXFP1) agonist with an EC50 of 0.34 nM. R2R01 activates RXFP1 to induce relaxin-like biological responses. R2R01 can increase heart rate in pithed and conscious rats. R2R01 can be used for the research of cardiovascular diseases. Product Information Product Name R2R01 Molecular Weight 4361.12…
RA-VII is an anti-tumor agent with significant activity against L1210, B-16 melanoma, Lewis lung carcinoma, Colon 38, and Ehrlich carcinoma. Product Details Product Name RA-VII Biological activity RA-VII is an antitumor agent that exhibits significant activity against L1210, B-16 melanoma, Lewis lung carcinoma, Colon 38 and Ehrlich carcinoma. CAS Number 86229-97-2 Storage Please store the…
Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils. Product Details Product Name Rabbit neutrophil peptide 3b Biological activity Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils. Sequence Shortening GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR (Disulfide bridge:C3-32;C5-C21;C11-C31) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Ranalexin is an antimicrobial peptide. Ranalexin inhibits Staphylococcus aureus, Escherichia coli, and Pseudomonas aeruginosa with MIC values of 4, 32, and 128 ??g/mL, respectively. Product Details Product Name Ranalexin Biological activity Ranalexin is an antimicrobial peptide. Ranalexin inhibits S. aureus, E. coli, P. aerugiaosa with MICs of 4, 32, 128 ??g/mL. Appearance Solid Color White…
RAWVAWR-NH2 is a polypeptide derived from human lysozyme with antibacterial activity. Product Details Product Name RAWVAWR-NH2 Biological activity RAWVAWR-NH2 is a peptide derived from human lysozyme with antibacterial activity. Sequence Arg-Ala-Trp-Val-Ala-Trp-Arg-NH2 Sequence Shortening RAWVAWR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
RBWH11 is a synthetic antimicrobial peptide. RBWH11 disrupts bacterial plasma membrane integrity, causing changes in membrane permeability and bacterial death. RBWH11 can eradicate preformed bacterial biofilms. RBWH11 has broad-spectrum antibacterial activity against Gram-negative and Gram-positive ESKAPE pathogens, including multidrug-resistant strains. RBWH11 can be used in research on multidrug-resistant bacterial infections. Product Details Product Name RBWH11…
RBWH15 is a synthetic broad-spectrum antimicrobial peptide. RBWH15 promotes the permeabilization of the bacterial outer and inner membranes, disrupts membrane integrity, and causes bacterial death. RBWH15 has biofilm-eradicating activity and can clear preformed bacterial biofilms. RBWH15 exhibits broad-spectrum antibacterial activity against Gram-negative and Gram-positive ESKAPE pathogens (including multidrug-resistant strains). RBWH15 can be used in research…
rCRAMP (rat) is a rat cathelicidin-related antimicrobial peptide that contributes to the antibacterial activity of rat brain peptide/protein extracts. rCRAMP (rat) is a key player in the innate immune system of the rat central nervous system. Product Details Product Name rCRAMP (rat) Biological activity rCRAMP (rat) is the rat cathelin-related antimicrobial peptide. rCRAMP (rat) contributes…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
