Product Name pTH (2-38) (human) Biological activity pTH (2-38) (human) is involved in the anabolic action of bone. PTH (2-38) can increase the level of serum INS-PTH (complete N-terminal specific PTH). CAS Number 154765-04-5 Sequence Sequence Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly Sequence Shortening Sequence Shortening VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG Storage Please store the product under the recommended conditions in the Certificate of…
Product Name pTH-Related Protein (1-37) (human, mouse, rat) Biological activity pTH-Related Protein (1-37) (human, mouse, rat), the peptide analogue of pTH-Related Protein (pTHrP). pTHrP refers to parathyroid-hormone-related protein, involved in physiological regulation of bone formation. CAS Number 206010-80-2 Sequence Sequence Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg Sequence Shortening Sequence Shortening AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIR Storage Please store the product under the recommended conditions…
Product Name pTH (73-84) (human) Biological activity pTH (73-84) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
Product Name Biotinyl-ACTH (1-39) (human) Biological activity Biotinyl-ACTH (1-39) (human) is abiotinylated Adrenocorticotropic Hormone (ACTH) (1-39), human (HY-P1211). CAS Number 1816258-26-0 Sequence Sequence {Biotin}-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening {Biotin}-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Katacalcin Biological activity Katacalcin (PDN 21) is a potent plasma calcium-lowering peptide. Formula Formula C97H154N34O36S2 CAS Number 85916-47-8 Appearance Solid Color White to off-white Sequence Sequence Asp-Met-Ser-Ser-Asp-Leu-Glu-Arg-Asp-His-Arg-Pro-His-Val-Ser-Met-Pro-Gln-Asn-Ala-Asn Sequence Shortening Sequence Shortening DMSSDLERDHRPHVSMPQNAN
Product Name pTH (53-84) (human) Biological activity pTH (53-84) (human) is apTH ((Human parathyroid hormone) fragment. CAS Number 89439-30-5 Sequence Sequence Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asn-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln Sequence Shortening Sequence Shortening KKEDNVLVESHEKSLGEADKADVNVLTKAKSQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (Ile8)-Oxytocin acetate Biological activity (Ile8)-Oxytocin acetate is a neurohypophysial hormone interoxitocin produced in marsupials. Appearance Solid Color White to off-white Sequence Sequence Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Ile-Gly-NH2 (Disulfide bridge: Cys1-Cys6) Sequence Shortening Sequence Shortening CYIQNCPIG-NH2 (Disulfide bridge: Cys1-Cys6) Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months;…
Product Name α-Synuclein (61-95) (human) Biological activity α-Synuclein (61-95) (human) is the hydrophobic core region of α-synuclein, and induces neuronal cell death. α-Synuclein (61-95) (human) can be used for research of neurodegenerative diseases, including Alzheimer??s disease (AD) and Parkinson??s disease (PD). Formula Formula C141H235N39O49 CAS Number 154040-19-4 Sequence Sequence Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val Sequence Shortening Sequence Shortening EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV…
Product Name pTH (1-84) (rat) Biological activity pTH (1-84) (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
Product Name (D-Leu6,Pro-NHEt9)-LHRH (4-9) Biological activity (D-Leu6,Pro-NHEt9)-LHRH (4-9) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 202333-85-5…
Product Name Adrenomedullin (AM) (1-52), human Biological activity Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide, which affects cell proliferation and angiogenesis in cancer. Formula Formula C264H406N80O77S3 CAS Number 148498-78-6 Appearance Solid Color White to off-white Sequence Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21) Sequence Shortening Sequence Shortening YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21) Storage Sealed storage, away…
Product Name Cortistatin-29 (human) Biological activity Cortistatin-29 (human) is a somatostatin neuropeptide with potential for studying diseases such as cancer, inflammation, autoimmunity, fibrosis, and pain. CAS Number 1815618-16-6 Appearance Solid Color White to off-white Sequence Sequence {Pyr}-Glu-Gly-Ala-Pro-Pro-Gln-Gln-Ser-Ala-Arg-Arg-Asp-Arg-Met-Pro-Cys-Arg-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Ser-Ser-Cys-Lys (Disulfide bridge: Cys17-Cys28) Sequence Shortening Sequence Shortening {Pyr}-EGAPPQQSARRDRMPCRNFFWKTFSSCK (Disulfide bridge: Cys17-Cys28) Storage Sealed storage, away from moisture Powder…
Product Name Adipokinetic hormone (Manduca sexta) Biological activity Adipokinetic Hormone (Apis mellifera ligustica, Bombyx mori, Heliothis zea, Manduca sexta) is a common peptide among various insects. Adipokinetic Hormone induces strong adipokinetic/hypertrehalosemic response. However Adipokinetic Hormone has no a glycogen-mobilizing function nor an adequate glycogen store in fat body for its effective utilization. CAS Number 99886-31-4…
Product Name pTH-Related Protein (7-34) amide (human, mouse, rat) Biological activity pTH-Related Protein (7-34) amide (human, mouse, rat) is a potent antagonist of parathyroid hormone (PTH). CAS Number 115695-30-2 Sequence Sequence Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH2 Sequence Shortening Sequence Shortening LLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name RFRP-3 (rat) Biological activity RFRP-3 (rat) is a neuropeptide. RFRP-3 (rat) inhibits gonadotropin secretion, causing a marked increase in ghrelin mRNA and plasma growth hormone levels. CAS Number 420088-80-8 Sequence Sequence Ala-Asn-Met-Glu-Ala-Gly-Thr-Met-Ser-His-Phe-Pro-Ser-Leu-Pro-Gln-Arg-Phe-NH2 Sequence Shortening Sequence Shortening ANMEAGTMSHFPSLPQRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
PuroA is a tryptophan-rich domain of Puroindoline a that exerts antibacterial activity through interaction with bacterial membranes. Product Details Product Name PuroA Biological activity PuroA is a tryptophan-rich domain of Puroindoline a that exerts antibacterial activity through interaction with bacterial membranes. Sequence Phe-Pro-Val-Thr-Trp-Arg-Trp-Trp-Lys-Trp-Trp-Lys-Gly-NH2 Sequence Shortening FPVTWRWWKWWKG-NH2 Storage Please store the product under the recommended conditions…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
