Insert HTML here
Showing 3169–3184 of 3705 results
Pap12-6-10 is an MD-2 ligand that binds the MD-2 hydrophobic pocket to inhibit TLR4/MD-2 complex dimerization and downstream inflammatory signaling; it also binds LPS to permeabilize bacterial cell membranes and induce oxidative stress leading to bacterial death. Pap12-6-10 regulates LPS-induced inflammatory responses through the TLR4 signaling pathway and has antibacterial activity against multidrug-resistant Gram-negative bacteria….
Papiliocin is a potent peptide antibiotic with both anti-inflammatory and antibacterial activities. Papiliocin is mainly active against Gram-negative bacteria. Papiliocin has high anti-inflammatory activity in cells, exerting its anti-inflammatory effects by inhibiting NO production and the secretion of TNF-?? and MIP-2. Papiliocin participates in innate defense response mechanisms by inhibiting the Toll-like receptor pathway and…
Amount: 5 mg Application: Cancer biomarker research Category: Cancer peptides, Cancer peptides Non-RGD Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Purity: >95% (HPLC-MS) Quantification: No Sequence: H-AYPGKF-NH2 Specifications:
Parasin I is a polypeptide composed of 19 amino acid residues derived from histone H2A isolated from catfish skin, with antibacterial effects. Product Details Product Name Parasin I Biological activity Parasin I is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity. Formula C82H154N34O24 CAS Number 219552-69-9…
Parasin I (TFA) is a polypeptide composed of 19 amino acid residues derived from histone H2A isolated from catfish skin, with antibacterial effects. Product Details Product Name Parasin I TFA Biological activity Parasin I (TFA) is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity. Appearance Solid…
Product Name Pancreatic polypeptide Biological activity Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion. Molecular Weight 4182.7 Formula Formula C185H286N52O55S2 CAS Number 59763-91-6 Appearance Solid Color White to off-white Sequence Sequence Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 Sequence Shortening Sequence…
Product Name Neuropeptide Y (18-36) (porcine) Biological activity Neuropeptide Y (18-36) (porcine) is a competitive neuropeptide Y (NPY) cardiac receptor antagonist. Neuropeptide Y (18-36) (porcine) inhibits the binding of I-NPY to cardiac ventricular membranes in a concentration-dependent manner with an IC50 value of 158 nM and an Ki value of 140 nM. Neuropeptide Y (18-36)…
Product Name Obestatin(human) Biological activity Obestatin(human) is a 23-amino acid amidated peptide that regulates appetite and gastrointestinal motility via its interaction with GPR39. Obestatin(human) can be used for weight loss. Obestatin(human) cannot penetrate the cell membrane. Molecular Weight 2546.86 Formula Formula C116H176N32O33 CAS Number 1081110-72-6 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening…
Product Name Sauvagine Biological activity Sauvagine is a corticotropin-releasing factor receptor (CRFR) agonist. Sauvagine activates HM-CRF receptors to stimulate intracellular cAMP accumulation, activates PC-CRF receptors to trigger associated signaling pathways, and stimulates the hypothalamic-pituitary-adrenal axis. Sauvagine can be used for research on central nervous system and blood diseases. Molecular Weight 4599.31 Formula Formula C202H346N56O63S CAS…
Product Name Leptin (93-105), human Biological activity Leptin (93-105), human, is the amino acids 93 to 105 fragment of human leptin. Leptin is a 167-residue peptide hormone mainly produced by adipocytes and acts in the central nervous system to primarily coordinate the metabolic adaptations to fasting. CAS Number 200436-43-7 Appearance Solid Color White to off-white…
Pardaxin P 4 is an antimicrobial peptide present in the secretions of the Red Sea Moses sole. Pardaxin P 4 acts as a perforator of biofilms, can interact with phospholipid bilayer membranes of different compositions, and induces cytotoxicity and pore formation. Pardaxin P 4 can be used in research on antibacterial drugs. Product Details Product…
Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with an MIC value of 13 ??M. Product Details Product Name Pardaxin P5 Biological activity Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 ??M. Sequence Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Asp-Gln-Glu Sequence Shortening GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE Storage Please store the product under the recommended…
Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is an antimicrobial peptide that inhibits Escherichia coli with an MIC value of 13 ??M. Product Details Product Name Pardaxin P5 TFA Biological activity Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is…
Product Name Neurokinin A Biological activity Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues. Molecular Weight 1133.32 Formula Formula C50H80N14O14S CAS Number 86933-74-6 Appearance Solid Color White to off-white Sequence Sequence His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 Sequence Shortening…
Pasireotide (SOM230), a long-acting cyclohexapeptide somatostatin analogue, can improve agonist activity at somatostatin receptors (subtypes sst1/2/3/4/5, pKi=8.2/9.0/9.1/
Pasireotide (SOM230) acetate, a long-acting cyclohexapeptide somatostatin analogue, can improve agonist activity at somatostatin receptors (subtypes sst1/2/3/4/5, pKi=8.2/9.0/9.1/
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us