Insert HTML here
Showing 3121–3136 of 3705 results
Pac-525 is a tryptophan-rich cationic antimicrobial peptide and membrane disruptor. Pac-525 has antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, anaerobes, Candida albicans, and Fusarium solani. Pac-525 strongly interacts with negatively charged phospholipid vesicles, inducing dye release from vesicles and disrupting microbial membranes. Pac-525 is cytotoxic to macrophages. Pac-525 can be used in research on bacterial…
Product Name Adrenocorticotropic Hormone (ACTH) (1-39), human Biological activity Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist. Molecular Weight 4541.14 Formula Formula C207H308N56O58S CAS Number 12279-41-3 Appearance Solid Color White to off-white Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Product Name Minigastrin Biological activity Minigastrin is an acidic peptide. Minigastrin can be used to study peptidepeptide interaction. CAS Number 60748-07-4 Sequence Sequence Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening LEEEEEAYGWMDF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (Gly14)-Humanin (human) acetate Biological activity (Gly14)-Humanin (human) (14-Glycine-Humanin (human)) acetate is an analog of Humanin in which the 14th amino acid serine was replaced with glycine (Gly). (Gly14)-Humanin (human) acetate has anti-apoptotic and neuroprotective functions. Molecular Weight 2657.21 (free acid) Formula Formula C118H202N34O31S2.xC2H4O2 Appearance Solid Color White to off-white Sequence Sequence Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala Sequence…
Product Name GLP-1(7-37) Biological activity GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Formula Formula C151H228N40O47 CAS Number 106612-94-6 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Product Name C-Type Natriuretic Peptide (1-53), human Biological activity C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone. Formula Formula C251H417N81O71S3 CAS Number 141294-77-1 Sequence Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys37-Cys55) Sequence Shortening…
Product Name Osteostatin (human) Biological activity Osteostatin (human), a fragment of parathyroid hormone-related protein (PTHrP) 107-139, promotes bone repair in animal models of bone defects and prevents bone erosion in inflammatory arthritis. Formula Formula C142H228N42O58 CAS Number 137348-10-8 Sequence Sequence Thr-Arg-Ser-Ala-Trp-Leu-Asp-Ser-Gly-Val-Thr-Gly-Ser-Gly-Leu-Glu-Gly-Asp-His-Leu-Ser-Asp-Thr-Ser-Thr-Thr-Ser-Leu-Glu-Leu-Asp-Ser-Arg Sequence Shortening Sequence Shortening TRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR Storage Please store the product under the recommended conditions…
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Control Layout: Freeze-dried in plastic vial Protein Name: Other Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-AKFVAAWTLKAAA-OH
Paenilagicin is a Gram-positive-active antibiotic with a dual polyprenyl phosphate binding mechanism that does not generate resistance, with an MIC value of 2 ??g/mL against multidrug-resistant Gram-positive bacteria. Product Details Product Name Paenilagicin Biological activity Paenilagicin is a Gram-positive active antibiotic with a unique diphosphorylated prenyl binding mechanism that does not induce drug resistance. Paenilagicin…
PAF26 is an antimicrobial peptide against the plant pathogenic fungi Penicillium digitatum, Penicillium italicum, and Botrytis cinerea. Product Details Product Name PAF26 Biological activity PAF26 is an antimicrobial peptide against phytopathogenic fungi Penicillium digitatum, Penicillium italicum and Botrytis cinerea. Color White to off-white Sequence Ac-{d-Arg}-{d-Lys}-{d-Lys}-{d-Trp}-{d-Phe}-{d-Trp}-NH2 Sequence Shortening Ac-{d-Arg}-{d-Lys}-{d-Lys}-{d-Trp}-{d-Phe}-{d-Trp}-NH2 Storage Sealed storage, away from moisture
Palicourein is a 37-amino-acid cyclic polypeptide that inhibits the cytopathic effect of HIV-1RF infection in CEM-SS cells in vitro, with an EC50 value of 0.1 ??M and an IC50 value of 1.5 ??M. Product Details Product Name Palicourein Biological activity Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects…
Palopegteriparatide (Transcon PTH; ACP-014) is a prodrug of parathyroid hormone PTH(1-34), which can maintain normal and stable calcium concentrations without the need for calcium and active vitamin D replacement. Palopegteriparatide can be used in research on hypoparathyroidism. Product Information Product Name Palopegteriparatide CAS Number 2222514-07-8 Sequence {X}-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe (X= O-methylpolyethylene glycol (2 x 20 kDa mPEG)-Aib)…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells, 25 ug (approx. 15 nmol) / peptide for stimulation of 2,5 x 108 cells, 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Pan Select Peptide Pools, PepMix Peptide…
Amount: 15 nmol (approx. 25??g) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease, Diabetes, Diarrhea Layout: Freeze-dried in glass vial Organism: Human Protein Name: Selected proteins Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: see additional product…
Amount: 15 nmol (approx. 25??g) / peptide for stimulation of 2,5 x 108 cells, 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Pan Select Peptide Pools, PepMix Peptide Pools Condition / Topic: Control, Cytomegalovirus disease, Infection, Infectious mononucleosis, Opportunistic infections Layout: Freeze-dried…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells, 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Pan Select Peptide Pools, PepMix Peptide Pools Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us