Product Name Adrenocorticotropic hormone (1-39), rat Biological activity Adrenocorticotropic hormone (1-39), rat is a potent melanocortin 2 (MC2) receptor agonist. Molecular Weight 4582.23 Formula Formula C210H315N57O57S CAS Number 77465-10-2 Appearance Solid Color White to off-white Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
PBP10 is a decapeptide. PBP10 selectively binds to lipoteichoic acid (LTA), lipopolysaccharide (LPS), and phosphatidylinositol-4,5-bisphosphate (PIP2). PBP10 can penetrate cell membranes and has bactericidal, anti-inflammatory, cell motility-inhibiting, and actin assembly-regulating effects. PBP10 can be used in research on bacterial infections, microbe-induced inflammation, skin and soft tissue infections, and sepsis. Product Details Product Name PBP10 Biological…
PBP10 TFA is a decapeptide. PBP10 selectively binds to lipoteichoic acid (LTA), lipopolysaccharide (LPS), and phosphatidylinositol-4,5-bisphosphate (PIP2). PBP10 TFA can penetrate cell membranes and has bactericidal, anti-inflammatory, cell motility-inhibiting, and actin assembly-regulating effects. PBP10 TFA can be used in research on bacterial infections, microbe-induced inflammation, skin and soft tissue infections, and sepsis. Product Details Product…
PCC16 chloride is a dual PROTAC degrader targeting DHHC3 and PD-L1, with a DC50 of 0.103 ??M for PD-L1 degradation. PCC16 chloride induces DHHC3 degradation via the ubiquitin-proteasome pathway by recruiting the CRBN E3 ubiquitin ligase (E3 ubiquitin ligase). By targeting DHHC3-which is essential for PD-L1 palmitoylation and membrane stability-PCC16 chloride reduces PD-L1 levels, decreases…
Peceleganan (PL-5) is an artificial antimicrobial hybrid peptide analog of cecropin A (1-10) ?? melittin B (3-18) (10+16). Peceleganan inhibits wound infection. Product Details Product Name Peceleganan Biological activity Peceleganan (PL-5) is an artificial antimicrobial cecropin A (1-10) ?? melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan inhibits wound infection. Molecular Weight 2933.5 Formula C???H???N??O?? CAS…
Peceleganan (PL-5) acetate is an artificial antimicrobial hybrid peptide analog of cecropin A (1-10) ?? melittin B (3-18) (10+16). Peceleganan acetate inhibits wound infection. Product Details Product Name Peceleganan acetate Biological activity Peceleganan (PL-5) acetate is an artificial antimicrobial cecropin A (1-10) ?? melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan acetate inhibits wound infection. Formula…
Pediocin PA-1 is a class IIa bacteriocin that forms voltage-independent hydrophilic pores by specifically binding to membrane proteins of sensitive Gram-positive bacteria (such as Listeria monocytogenes), leading to dissipation of the proton motive force, ATP depletion, and cell death. Pediocin PA-1 has no significant activity against intact Gram-negative bacteria, strains carrying immunity genes, or obligate…
Pediocin PA-1 TFA is a class IIa bacteriocin that forms voltage-independent hydrophilic pores by specifically binding to membrane proteins of sensitive Gram-positive bacteria (such as Listeria monocytogenes), leading to dissipation of the proton motive force, ATP depletion, and cell death. Pediocin PA-1 TFA has no significant activity against intact Gram-negative bacteria, strains carrying immunity genes,…
Pegloxenatide (Polyethylene glycol loxenatide) is a long-acting glucagon-like peptide-1 receptor (GLP-1RA) agonist. Pegloxenatide has various activities such as lowering blood glucose, lowering blood lipids, improving body weight, anti-inflammation, promoting wound healing, protecting the liver, and protecting the heart. Pegloxenatide can be used in the research of type 2 diabetes and its multiple complications. Product Information…
Pegsebrenatide (NLY01) is a blood-brain barrier-penetrant GLP-1R agonist. Pegsebrenatide alleviates retinal inflammation and neuronal death secondary to ocular hypertension. Pegsebrenatide significantly delays onset and reduces disease severity in experimental autoimmune encephalomyelitis. Pegsebrenatide inhibits the formation of A1 reactive astrocytes in nerve cells and reduces the loss of retinal ganglion cells and dopaminergic neurons. Pegsebrenatide exerts…
Pelteobagrin is a broad-spectrum antimicrobial peptide targeting Gram-positive bacteria, Gram-negative bacteria, and fungi (MIC=2-16 ??g/mL). Pelteobagrin exerts bactericidal effects by non-competitively disrupting the integrity of the cell wall and cytoplasmic membrane. Pelteobagrin is expected to be used in research on infectious diseases. Product Details Product Name Pelteobagrin Biological activity Pelteobagrin is a broad-spectrum antimicrobial peptide…
Pemvidutide (ALT-801) is a GLP-1R/GCGR dual agonist, shows striking reductions in body weight, liver fat and serum lipids. Pemvidutide can be used in non-alcoholic steatohepatitis (NASH) and obesity research. Product Information Product Name Pemvidutide Molecular Weight 3873.35 Formula C182H275N39O54 CAS Number 2538014-94-5 Appearance Solid Color White to off-white Sequence His-{Aib}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu–{Lys(N6-(1-O-(17-Carboxyheptadecyl)-D-Glucopyranuronoyl))}-Ala-Ala-Lys-Glu-Phe-Ile-Gln-Trp-Leu-Leu-Gln-Thr-NH2 (Lactam bridge: Glu-16;Lys-20) Sequence Shortening…
Product Name [Glu4]-Oxytocin Biological activity -Oxytocin is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of ??oxytocin-like?? molecules in aqueous solution. CAS Number 4314-67-4 Appearance Solid Color White to off-white Sequence Sequence Cys-Tyr-Ile-Glu-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge:Cys1-Cys6) Sequence Shortening Sequence Shortening CYIENCPLG-NH2 (Disulfide bridge:Cys1-Cys6) Storage Sealed storage,…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
