Insert HTML here
Showing 3153–3168 of 3705 results
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Category: PepMix Pan Select Peptide Pools, PepMix Peptide Pools Condition / Topic: Infection Layout: Freeze-dried in glass vial Organism: Human Protein Name: Selected proteins Quantification: No Sequence: see additional product documentation
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells, 15 nmol /peptide Category: PepMix Pan Select Peptide Pools, PepMix Peptide Pools Condition / Topic: Infection, Yellow Fever Layout: Freeze-dried in glass vial Organism: Yellow Fever Virus (YFV) Protein Name: Selected proteins Quantification: No Sequence: see additional product documentation
Product Name Substance P (5-11) TFA Biological activity Substance P (5-11) TFA TFA, the C-terminal heptapeptide of Substance P (HY-P0201), is a neuropeptide. Substance P (5-11) TFA TFA binds to NK-1 tachykinin receptor. Formula Formula C41H60N10O9S.xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening QQFFGLM-NH2 Storage Sealed storage, away from…
Product Name Pancreastatin (37-52), human Biological activity Pancreastatin (37-52), human is a pancreastatin fragment. Pancreastatin a CgA-derived peptide (CgA residues 250?C301) with biological activity, inhibited the releasing of insulin by islet beta cells. CAS Number 133605-57-9 Sequence Sequence Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2 Sequence Shortening Sequence Shortening EEEEEMAVVPQGLFRG-NH2 Storage Please store the product under the recommended conditions in the…
Product Name Substance P-Gly-Lys-Arg Biological activity Substance P-Gly-Lys-Arg, also known as β-Preprotachykinin (58-71), is an analog of Substance P (HY-P0201). CAS Number 123148-51-6 Sequence Shortening Sequence Shortening RPKPQQFFGLMGKR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Biotinyl-neuropeptide W-23 (human) Biological activity Biotinyl-neuropeptide W-23 (human) is a biotinylated Neuropeptide W-23 (human) (HY-P1035). Neuropeptide W-23 (human) is an agonist of NPBW1 (GPR7) and NPBW2 (GPR8). CAS Number 1815618-09-7 Appearance Solid Color White to off-white Sequence Sequence Biotin-Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu Sequence Shortening Sequence Shortening Biotin-WYKHVASPRYHTVGRAAGLLMGL Storage Sealed storage, away from moisture Powder -80??C 2…
Product Name (Glu17,21,24)-Osteocalcin (1-49) (human) Biological activity (Glu17,21,24)-Osteocalcin (1-49) (human) is a bone-specific protein involved in bone formation and glucose metabolism. CAS Number 1927927-11-4 Appearance Solid Color White to off-white Sequence Sequence Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val (Disulfide bridge: Cys23-Cys29) Sequence Shortening Sequence Shortening YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge: Cys23-Cys29) Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C…
Product Name Adrenomedullin (AM) (13-52), human Biological activity Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent. Formula Formula C200H308N58O59S2 CAS Number 154765-05-6 Appearance Solid Color White to off-white Sequence Sequence Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9) Sequence Shortening Sequence Shortening SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys4-Cys9) Storage Sealed storage, away…
Product Name Neuromedin U, rat Biological activity Neuromedin U, rat is a 23-amino acid brain-gut peptide. Neuromedin U (NMU), through its cognate receptor NMUR2 in the central nervous system, regulates several important physiological functions, including energy balance, stress response, and nociception. Molecular Weight 2642.97 Formula Formula C124H180N34O31 CAS Number 117505-80-3 Sequence Sequence Tyr-Lys-Val-Asn-Glu-Tyr-Gln-Gly-Pro-Val-Ala-Pro-Ser-Gly-Gly-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 Sequence Shortening…
Product Name Orexin A (human, rat, mouse) TFA Biological activity Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)) TFA, a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) TFA binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor…
Amount: 1.0 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Diabetes Peptide Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Product Name Pancreatic Polypeptide, bovine Biological activity Pancreatic Polypeptide, bovine, a 36-amino acid, straight chain polypeptide derived primarily from the pancreas, inhibits secretin- and cholecystokinin-stimulated pancreatic secretion; Pancreatic Polypeptide, bovine acts as an agonist of NPY receptor, with high affinity at NPYR4. Molecular Weight 4225.78 Formula Formula C186H287N53O56S2 CAS Number 179986-89-1 Sequence Sequence Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 Sequence…
Pantinin-1 is an antimicrobial peptide present in the venom of Pandinus imperator. Pantinin-1 has potent antibacterial activity against Gram-positive bacteria and fungi, weaker antibacterial activity against Gram-negative bacteria, and extremely low hemolytic activity against human erythrocytes. Pantinin-1 also has anticancer activity and can induce apoptosis in tumor cells. Product Details Product Name Pantinin-1 Biological activity…
Pantinin-2 is a cysteine-free venom peptide present in the emperor scorpion (Pandinus imperator). Pantinin-2 has high activity against Gram-positive bacteria but weak activity against Gram-negative bacteria. Pantinin-2 also exhibits activity against Candida tropicalis and has relatively mild hemolytic activity against human erythrocytes. Pantinin-2 can be used in the development of antibacterial drugs against drug-resistant pathogens….
Pantinin-3 is an antimicrobial peptide present in the venom of the emperor scorpion (Pandinus imperator) with anti-tumor activity. Pantinin-3 shows selective toxicity against breast cancer cells (MDA-MB-231) and prostate cancer cells (DU-145). Pantinin-3 can induce apoptosis in tumor cells. Pantinin-3 can be used in research in the field of cancer. Product Details Product Name Pantinin-3…
Pap12-6 is a 12-mer short peptide derived from Papiliocin, an antimicrobial peptide from the larvae of the yellow-striped butterfly. Pap12-6 kills bacteria by penetrating and disrupting bacterial membranes, exhibiting potent antibacterial activity. Pap12-6 exerts anti-inflammatory effects through the TLR4-mediated NF-??B signaling pathway. Product Details Product Name Pap12-6 Biological activity Pap12-6 is a 12-mer peptide derived…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us