Papiliocin
Description
Papiliocin is a potent peptide antibiotic with both anti-inflammatory and antibacterial activities. Papiliocin is mainly active against Gram-negative bacteria. Papiliocin has high anti-inflammatory activity in cells, exerting its anti-inflammatory effects by inhibiting NO production and the secretion of TNF-?? and MIP-2. Papiliocin participates in innate defense response mechanisms by inhibiting the Toll-like receptor pathway and NF-??B. Papiliocin induces fungal cell apoptosis and elevates total intracellular ROS levels. Papiliocin acts as an effective antiseptic peptide in sepsis models. Papiliocin can be used in anti-inflammatory and antibacterial research.
Product Details
| Product Name | Papiliocin |
| Biological activity | Papiliocin is a potent peptide antibiotic with both anti-inflammatory and antibacterial activities. Papiliocin is primarily active against Gram-negative bacteria. Papiliocin exhibits strong anti-inflammatory activity against cell, exerting its anti-inflammatory activity by inhibiting the production of NO and the secretion of TNF-?? and MIP-2. Papiliocin participates in the innate defense response mechanism by inhibiting the Toll-like receptor pathway and NF-??B. Papiliocin induces apoptosis in fungal cells and increases the total level of intracellular ROS. Papiliocin acts as an effective antiseptic peptide in sepsis models. Papiliocin is useful in anti-inflammatory and antibacterial research. |
| Formula | C183H314N56O44 |
| Sequence | Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Val-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Ala-Thr-Val-Val-Lys-NH2 |
| Sequence Shortening | RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK-NH2 |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
