Pardaxin P 4
Description
Pardaxin P 4 is an antimicrobial peptide present in the secretions of the Red Sea Moses sole. Pardaxin P 4 acts as a perforator of biofilms, can interact with phospholipid bilayer membranes of different compositions, and induces cytotoxicity and pore formation. Pardaxin P 4 can be used in research on antibacterial drugs.
Product Details
| Product Name | Pardaxin P 4 |
| Biological activity | Pardaxin P 4 is an antimicrobial peptide found in the secretions of Red Sea Moses sole. Pardaxin P 4 acts as a biomembrane perforator that can interact with phospholipid bilayers of different compositions and induce cytotoxicity and pore formation. Pardaxin P 4 can be used in the research of antimicrobial drugs. |
| Sequence | Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Gly-Gln-Glu |
| Sequence Shortening | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
