Insert HTML here
Showing 529–544 of 667 results
Plectasin is a peptide antibiotic from saprophytic fungi. Plectasin kills Streptococcus pneumoniae in vitro. Plectasin alleviates experimental peritonitis and pneumonia caused by Streptococcus pneumoniae in mice. Product Details Product Name Plectasin Biological activity Plectasin is a peptide antibiotic derived from saprophytic fungi. Plectasin can kill pneumococcus in vitro. Plectasin can alleviate experimental peritonitis and pneumonia…
Pleurocidin is an antimicrobial peptide. Pleurocidin can be derived from the skin mucosa or intestinal secretions of Pseudopleuronectes americanus. Pleurocidin inhibits the expression of key proteins in the MAPK and NF-??B inflammatory signaling pathways. Pleurocidin alters serum inflammatory and immune cytokine levels, regulates the downregulation of tight junction proteins, and modulates gut microbiota. Pleurocidin induces…
Plipastatin B1 is a lipopeptide antibiotic and an inhibitor of phospholipase A2 (PLA2) with antifungal activity. Product Details Product Name Plipastatin B1 Biological activity Plipastatin B1 is a lipopeptide antibiotic, an inhibitor of phospholipase A2 (PLA2), which has antifungal activity. Sequence {(R)-3-Hydroxyhexadecanoic acid-Glu}-{Orn}-YTEVPQYI Sequence Shortening {(R)-3-Hydroxyhexadecanoic acid-Glu}-{Orn}-Tyr-Thr-Glu-Val-Pro-Gln-Tyr-Ile Storage Please store the product under the recommended…
PMAP-23 is a biologically active peptide (an antimicrobial peptide (AMP) derived from porcine bone marrow). Product Details Product Name PMAP-23 Biological activity PMAP-23 is a biological active peptide. (an antimicrobial peptide (AMP) derived from porcine myeloid.) Appearance Solid Color White to off-white Sequence Arg-Ile-Ile-Asp-Leu-Leu-Trp-Arg-Val-Arg-Arg-Pro-Gln-Lys-Pro-Lys-Phe-Val-Thr-Val-NH2 Sequence Shortening RIIDLLWRVRRPQKPKFVTVWVR-NH2 Storage Sealed storage, away from moisture
PMAP-36 is an antimicrobial peptide with the sequence GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. Product Details Product Name PMAP-36 Biological activity PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance. Appearance Solid Color White to light yellow Sequence Gly-Arg-Phe-Arg-Arg-Leu-Arg-Lys-Lys-Thr-Arg-Lys-Arg-Leu-Lys-Lys-Ile-Gly-Lys-Val-Leu-Lys-Trp-Ile-Pro-Pro-Ile-Val-Gly-Ser-Ile-Pro-Leu-Gly-Cys-Gly Sequence Shortening GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG Storage Sealed storage, away from moisture
Polistes mastoparan is an antimicrobial peptide. Polistes mastoparan increases K+ efflux from S. aureus and inhibits S. aureus viability, with an EC50 of 5 ??M. Product Details Product Name Polistes mastoparan Biological activity Polistes mastoparan is an antimicrobial peptide. Polistes mastoparan increases S. aureus cell K+ efflux and inhibits cell viability with EC50 of 5…
Polyalanine peptide (pALA) is an antimicrobial peptide targeting biofilms and Gram-negative bacteria, and is non-toxic to mammalian cells. Polyalanine peptide forms an ??-helical conformation that effectively permeabilizes Gram-negative bacterial membranes, thereby inducing lethal cell leakage. Polyalanine peptide can be used in anti-infection research. Product Details Product Name Polyalanine peptide Biological activity Polyalanine peptide (pALA) is…
Polybia-MP1 is an antimicrobial peptide with antibacterial, antifungal, and anticancer activities. Polybia-MP1 selectively targets cancer cells by interacting with PS and PE in the outer leaflet of the cell membrane, inducing necrosis through pore formation. Polybia-MP1 exhibits antibacterial activity against Pseudomonas aeruginosa. Polybia-MP1 can be used in research on bacterial infections, fungal infections, and cancer….
Polymyxin B nonapeptide is a cationic cyclic peptide. Polymyxin B nonapeptide is a derivative produced by enzymatic cleavage of Polymyxin B. Compared with Polymyxin B, Polymyxin B nonapeptide has lower toxicity and lacks bactericidal activity, but retains the ability to disrupt the outer membrane of Gram-negative bacteria. Product Details Product Name Polymyxin B nonapeptide Biological…
Polymyxin B nonapeptide TFA is a cationic cyclic peptide. Polymyxin B nonapeptide TFA is a derivative produced by enzymatic cleavage of Polymyxin B. Compared with Polymyxin B, Polymyxin B nonapeptide TFA has lower toxicity and lacks bactericidal activity, but retains the ability to disrupt the outer membrane of Gram-negative bacteria. Product Details Product Name Polymyxin…
Polymyxin B Sulfate is an antibiotic. Polymyxin B Sulfate inhibits Gram-negative bacterial infection by binding with high affinity to LPS of the bacterial wall. Polymyxin B Sulfate can neutralize the effects of endotoxin. Polymyxin B Sulfate induces bacterial death by increasing its permeability. Polymyxin B Sulfate can be used in research on endotoxemia. Product Details…
Polymyxin B1 is a potent antibacterial lipopeptide derived from Paenibacillus polymyxa. Polymyxin B1 is the major component of Polymyxin B (HY-A0248). Polymyxin B1 induces bacterial cell lysis through interaction with the bacterial cell membrane. Polymyxin B1 can be used in research on multidrug-resistant Gram-negative bacterial infections. Product Details Product Name Polymyxin B1 Biological activity Polymyxin…
Polymyxin B1-D-Leu-d7 TFA is a deuterium-labeled Polymyxin B1 (HY-A0248A). Polymyxin B1 is a potent antibacterial lipopeptide derived from Paenibacillus polymyxa. Polymyxin B1 is the major component of Polymyxin B (HY-A0248). Polymyxin B1 induces bacterial cell lysis through interaction with the bacterial cell membrane. Polymyxin B1 can be used in research on multidrug-resistant Gram-negative bacterial infections….
Polymyxin B1-d7 TFA is a deuterated form of Polymyxin B1 TFA (HY-A0248A). Polymyxin B1 is a potent antibacterial lipopeptide derived from Paenibacillus polymyxa. Polymyxin B1 is the major component of Polymyxin B (HY-A0248). Polymyxin B1 induces bacterial cell lysis through interaction with the bacterial cell membrane. Polymyxin B1 can be used in research on multidrug-resistant…
Polymyxin B2 is a polypeptide antibiotic with antibacterial activity particularly against Gram-negative bacteria. Polymyxin B2 binds to lipopolysaccharide molecules on the bacterial cell membrane, disrupting membrane integrity and causing leakage of cellular contents, thereby killing bacteria. Polymyxin B2 can be used in research on Pseudomonas aeruginosa infection and acute enteritis. Product Details Product Name Polymyxin…
Polyphemusin I is a natural antimicrobial peptide with excellent antibacterial activity against Gram-negative and Gram-positive bacteria. Polyphemusin I contains 18 amino acids and is stabilized by two disulfide bridges into an amphipathic antiparallel ??-hairpin. Product Details Product Name Polyphemusin I Biological activity Polyphemusin I is a natural antimicrobial peptide with excellent antimicrobial activity against Gram-negative…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Antimicrobial Peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us