Insert HTML here
Showing 497–512 of 667 results
Pardaxin P 4 is an antimicrobial peptide present in the secretions of the Red Sea Moses sole. Pardaxin P 4 acts as a perforator of biofilms, can interact with phospholipid bilayer membranes of different compositions, and induces cytotoxicity and pore formation. Pardaxin P 4 can be used in research on antibacterial drugs. Product Details Product…
Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with an MIC value of 13 ??M. Product Details Product Name Pardaxin P5 Biological activity Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 ??M. Sequence Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Asp-Gln-Glu Sequence Shortening GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE Storage Please store the product under the recommended…
Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is an antimicrobial peptide that inhibits Escherichia coli with an MIC value of 13 ??M. Product Details Product Name Pardaxin P5 TFA Biological activity Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is…
PBP10 is a decapeptide. PBP10 selectively binds to lipoteichoic acid (LTA), lipopolysaccharide (LPS), and phosphatidylinositol-4,5-bisphosphate (PIP2). PBP10 can penetrate cell membranes and has bactericidal, anti-inflammatory, cell motility-inhibiting, and actin assembly-regulating effects. PBP10 can be used in research on bacterial infections, microbe-induced inflammation, skin and soft tissue infections, and sepsis. Product Details Product Name PBP10 Biological…
PBP10 TFA is a decapeptide. PBP10 selectively binds to lipoteichoic acid (LTA), lipopolysaccharide (LPS), and phosphatidylinositol-4,5-bisphosphate (PIP2). PBP10 TFA can penetrate cell membranes and has bactericidal, anti-inflammatory, cell motility-inhibiting, and actin assembly-regulating effects. PBP10 TFA can be used in research on bacterial infections, microbe-induced inflammation, skin and soft tissue infections, and sepsis. Product Details Product…
Peceleganan (PL-5) is an artificial antimicrobial hybrid peptide analog of cecropin A (1-10) ?? melittin B (3-18) (10+16). Peceleganan inhibits wound infection. Product Details Product Name Peceleganan Biological activity Peceleganan (PL-5) is an artificial antimicrobial cecropin A (1-10) ?? melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan inhibits wound infection. Molecular Weight 2933.5 Formula C???H???N??O?? CAS…
Peceleganan (PL-5) acetate is an artificial antimicrobial hybrid peptide analog of cecropin A (1-10) ?? melittin B (3-18) (10+16). Peceleganan acetate inhibits wound infection. Product Details Product Name Peceleganan acetate Biological activity Peceleganan (PL-5) acetate is an artificial antimicrobial cecropin A (1-10) ?? melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan acetate inhibits wound infection. Formula…
Pediocin PA-1 is a class IIa bacteriocin that forms voltage-independent hydrophilic pores by specifically binding to membrane proteins of sensitive Gram-positive bacteria (such as Listeria monocytogenes), leading to dissipation of the proton motive force, ATP depletion, and cell death. Pediocin PA-1 has no significant activity against intact Gram-negative bacteria, strains carrying immunity genes, or obligate…
Pediocin PA-1 TFA is a class IIa bacteriocin that forms voltage-independent hydrophilic pores by specifically binding to membrane proteins of sensitive Gram-positive bacteria (such as Listeria monocytogenes), leading to dissipation of the proton motive force, ATP depletion, and cell death. Pediocin PA-1 TFA has no significant activity against intact Gram-negative bacteria, strains carrying immunity genes,…
Pelteobagrin is a broad-spectrum antimicrobial peptide targeting Gram-positive bacteria, Gram-negative bacteria, and fungi (MIC=2-16 ??g/mL). Pelteobagrin exerts bactericidal effects by non-competitively disrupting the integrity of the cell wall and cytoplasmic membrane. Pelteobagrin is expected to be used in research on infectious diseases. Product Details Product Name Pelteobagrin Biological activity Pelteobagrin is a broad-spectrum antimicrobial peptide…
Penta lysine is an antimicrobial peptide. Penta lysine inhibits the growth of Gram-positive bacteria (including methicillin-resistant Staphylococcus aureus and Bacillus subtilis) and Gram-negative bacteria (including E. coli, Acinetobacter baumannii, and Pseudomonas aeruginosa). Penta lysine induces hemolysis of human erythrocytes. Penta lysine can be used in research on bacterial infections (including MRSA and P. aeruginosa infections)….
Peptide 12d is an antimicrobial peptide isolated from the venom of the giant hornet. Peptide 12d mediates antimicrobial responses by stimulating mast cell degranulation. Product Details Product Name Peptide 12d Biological activity Peptide 12d is an antimicrobial peptide isolated from the venom of wasp. Peptide 12d mediates antimicrobial response by stimulating mast cell degranulation ….
Peptide 5e is an antimicrobial peptide. Peptide 5e inhibits E. coli, S. aureus, and C. albicans with MIC values of 30, 5, and 25 ??g/mL, respectively. Product Details Product Name Peptide 5e Biological activity Peptide 5e is an antimicrobial peptide. Peptide 5e inhibits E. coli, S. aureus, and C. albicans with MIC values of 30,…
Peptide 5f is an antimicrobial peptide derived from bumblebee venom. Peptide 5f has antibacterial activity against bacteria and fungi. Peptide 5f has almost no hemolytic activity against human erythrocytes. Product Details Product Name Peptide 5f Biological activity Peptide 5f is an antimicrobial peptide derived from wasp venom. Peptide 5f has antimicrobial activity against bacteria and…
Peptide 5g is an antimicrobial peptide. Peptide 5g inhibits E. coli, S. aureus, and C. albicans with MIC values of 30, 10, and 12.5 ??g/mL, respectively. Product Details Product Name Peptide 5g Biological activity Peptide 5g is an antimicrobial peptide. Peptide 5g inhibits E. coli, S. aureus, and C. albicans with MIC values of 30,…
Peptide HV2 is an antibiotic that exerts anti-inflammatory effects by inhibiting TNF-??. Peptide HV2 has antibacterial activity. Product Details Product Name Peptide HV2 Biological activity Peptide HV2 is an antibiotic that exerts anti-inflammatory effects by inhibiting TNF-??. Peptide HV2 has antibacterial activity. Sequence Shortening RRVHVH-{dVal}-PGVHVHVRR-NH2 Storage Please store the product under the recommended conditions in…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Antimicrobial Peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us