??-Defensin-4 human is an inducible peptide with a specific salt-sensitive antimicrobial activity profile. Product Details Product Name ??-Defensin-4 (human) Biological activity ??-Defensin-4 human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity. Sequence Glu-Leu-Asp-Arg-Ile-Cys-Gly-Tyr-Gly-Thr-Ala-Arg-Cys-Arg-Lys-Lys-Cys-Arg-Ser-Gln-Glu-Tyr-Arg-Ile-Gly-Arg-Cys-Pro-Asn-Thr-Tyr-Ala-Cys-Cys-Leu-Arg-Lys (disulfide bridge: Cys6-Cys33, Cys13-Cys27, Cys17-Cys34) Sequence Shortening ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK (disulfide bridge: Cys6-Cys33, Cys13-Cys27, Cys17-Cys34) Storage Please store the product…
??-defensin 1 (pig) (pBD-1) is an endogenous, constitutively expressed antimicrobial peptide (AMP) derived from porcine tissues, particularly expressed at porcine mucosal epithelial sites. ??-defensin 1 (pig) has antibacterial effects and contributes to porcine mucosal and systemic host defense. Product Details Product Name ??-defesin 1 (pig) Biological activity ??-defesin 1 (pig) (pBD-1) is an endogenous and…
(K(C10)GGGRrRPC)2 (Compound (C-C10)C-C) is a dimeric lipopeptide and antibacterial agent. (K(C10)GGGRrRPC)2 enhances the accumulation of reactive oxygen species (ROS) and inhibits the activity of bacterial respiratory chain dehydrogenase. (K(C10)GGGRrRPC)2 significantly inhibits bacterial biofilm formation. (K(C10)GGGRrRPC)2 has antibacterial activity against Acinetobacter baumannii AB1901, Acinetobacter baumannii AB1902, Pseudomonas aeruginosa 25349, and Staphylococcus aureus 11011, with MIC values…
[(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92) is a selective inhibitor of HIV-1. [(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92) mainly inhibits viral infection and cell fusion by blocking the interaction between HIV-1 and the CD4 molecule. It can completely inhibit fusion formation at a concentration of 25 ??M. Product Details Product Name [(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92) Biological activity CD4 (81-92) is a selective inhibitor of HIV-1….
3-WP is a linear icosapeptide with C-terminal amidation modification. 3-WP acts on lipoteichoic acid (LTA) and disrupts cell wall permeability, induces intracellular reactive oxygen species (ROS) accumulation in a dose-dependent manner, and inhibits respiratory chain dehydrogenase activity and intracellular ATP synthesis, thereby interfering with bacterial energy metabolism and exerting antibacterial effects. Combined use of 3-WP…
5-FAM-Ahx-LL-37 TFA is LL-37, human (HY-P1222) labeled with 5-FAM (HY-66022). The carboxyfluorescein group is linked via 6-aminohexanoic acid (Ahx, HY-B0236). LL-37, human is a 37-residue amphipathic antimicrobial peptide derived from cathelicidin with broad-spectrum antibacterial activity. Product Details Product Name 5-FAM-Ahx-LL-37 TFA Biological activity 5-FAM-Ahx-LL-37 TFA is a 5-FAM (HY-66022) labeled LL-37, human (HY-P1222). The carboxyfluorescein…
5-FAM-LL-37 is a fluorescence-labeled LL-37, human (HY-P1222). Product Details Product Name 5-FAM-LL-37 Biological activity 5-FAM-LL-37 is afluorescent labeled LL-37, human (HY-P1222). Sequence {Fluorescein-5-carbonyl}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH Sequence Shortening {Fluorescein-5-carbonyl}[LL-37, 37 aa] Storage Please store the product under the recommended conditions in the Certificate of Analysis.
5-FAM-LL-37 (scrambled) is a polypeptide that can be discovered by peptide screening. Peptide screening is a research tool that primarily collects active peptides through immunoassays. Peptide screening can be used in protein interaction, functional analysis, and antigen epitope screening, especially in the field of active molecule research and development. Product Details Product Name 5-FAM-LL-37 (scrambled)…
5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37 (HY-P5057). It is a fluorescein-labeled LL-37 peptide that retains the antibacterial and immunomodulatory activities of LL-37. 5-FAM-LL-37 TFA binds to bacterial cell membranes, disrupts membrane integrity, and exhibits broad-spectrum antibacterial activity. Product Details Product Name 5-FAM-LL-37 TFA Biological activity 5-FAM-LL-37 TFA is the TFA salt form…
A-54556A is a ClpP-binding bactericidal agent whose antibacterial activity depends on functional ClpP. Loss or inactivation of ClpP confers resistance in Gram-positive bacteria and E. coli efflux pump mutants. A-54556A can be used in research on bacterial infections. Product Details Product Name A-54556A Biological activity A-54556A is a bactericide that binds to ClpP, and its…
A3-APO is an antimicrobial peptide. A3-APO exerts significant antibacterial activity through a dual mode of action (membrane lysis and inhibition of intracellular targets). A3-APO can inactivate bacterial toxins and increase the expression of anti-inflammatory cytokines (such as IL-4 and IL-10) without inducing resistance. A3-APO accelerates burn wound healing in mouse models infected with Acinetobacter baumannii…
A83586C is a novel peptide antibiotic with antibacterial activity against Gram-positive bacteria. Product Details Product Name A83586C Biological activity A83586C is a new type of peptide antibiotic that is effective against Gram-positive bacteria. Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Abaecin is an antimicrobial response peptide. Abaecin shows specific activity against Apidaecin-resistant Xanthomonas strains. Product Details Product Name Abaecin Biological activity Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas strain. Appearance Solid Color White to off-white Sequence Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr Sequence Shortening YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY Storage Sealed storage, away from moisture
Acetyl-Adhesin (1025-1044) amide is a 20-peptide fragment of the Streptococcus mutans cell surface adhesin that can serve as an antimicrobial peptide, specifically inhibiting the binding of adhesin to salivary receptors and preventing recolonization of S. mutans. Product Details Product Name Acetyl-Adhesin (1025-1044) amide Biological activity Acetyl-Adhesin (1025-1044) amide is a 20-peptide fragment of Streptococcus pyogenes…
AcrAP1 (AP1-Z1) is an antimicrobial peptide present in the venom of the Arabian scorpion (Androctonus crassicauda). AcrAP1 has antibacterial activity and inhibits the growth of Gram-positive bacteria, Gram-negative bacteria, and yeast. AcrAP1 exerts anti-tumor activity by promoting apoptosis of cancer cells and inhibiting angiogenesis. AcrAP1 can be used in cancer research. Product Details Product Name…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
![[(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92)](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides3-300x300.jpg)
