Insert HTML here
Showing 17–32 of 667 results
AcrAP2 is an antimicrobial peptide present in the venom of the Arabian scorpion (Androctonus crassicauda). AcrAP2 has inhibitory effects on Gram-positive bacteria and yeast but is essentially inactive against Gram-negative bacteria. The cation-enhanced AcrAP2 analog (AcrAP2a) shows significant antiproliferative effects against certain human cancer cell lines at low concentrations. AcrAP2 can be used in research…
Actagardin is a tetracyclic lantibiotic produced by several motile actinomycetes. It consists of macrocycles formed by thioether bridges. Actagardin mainly targets Gram-positive bacteria and inhibits peptidoglycan synthesis. Product Details Product Name Actagardin Biological activity Actagardin is a tetracyclic lantibiotic produced by several species of Actinoplanes. It is composed of macrocyclic rings formed by thioether bridges….
Actinomycin X2 (Actinomycin V) is produced by many Streptomyces species and shows strong inhibitory activity against MRSA, with a minimum inhibitory concentration (MIC) value of 0.25 ??g/mL. Actinomycin X2 can be used in cancer and bacterial infection research. Product Details Product Name Actinomycin X2 (purity??85%) Biological activity Actinomycin X2 (Actinomycin V), produced by many Streptomyces…
Adenoregulin (Dermaseptin b2) is an antimicrobial peptide antibiotic. Adenoregulin is active against Gram-negative and Gram-positive bacteria, yeast, and fungi. Adenoregulin also enhances the binding of agonists to the A1 adenosine receptor. Product Details Product Name Adenoregulin Biological activity Adenoregulin (Dermaseptin b2) is an antimicrobial peptide antibiotic. Adenoregulin is active against Gram-negative and Gram-positive bacteria, yeast…
AEC5 is a lipopeptide substance with antifungal activity against Cryptococcus neoformans infection. At the MIC concentration (6.3 ??g/mL) against C. neoformans, AEC5 shows no significant cytotoxicity against human lung, liver, or red blood cells. Product Details Product Name AEC5 Biological activity AEC5 is a Lipopeptoid with antifungal activity against Cryptococcus neoformans. AEC5 has no observable…
Aeschna defensin is an antimicrobial peptide derived from the hemolymph of dragonfly aquatic larvae. Aeschna defensin has strong activity against Gram-positive bacteria. Product Details Product Name Aeschna defensin Biological activity Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria. Sequence Shortening GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR (Disulfide…
ALA-A2 is an anticancer peptide discovered in ??-lactalbumin that selectively kills cancer cells by inducing autophagy. ALA-A2 has cell-penetrating function and can effectively enter cells without relying on membrane-lytic effects. In A549 lung cancer cells, ALA-A2 exhibits significant dose-dependent anticancer activity. ALA-A2 is expected to be used in research in the fields of anticancer therapy…
Alamethicin is a linear 20-amino-acid antibiotic that induces voltage-gated conductance in model and cell membranes. Alamethicin shows antibacterial activity against Gram-positive bacteria but not against Gram-negative bacteria. Alamethicin can form amphipathic ??-helical structures in biofilms. Product Details Product Name Alamethicin Biological activity Alamethicin is a linear 20-amino acid antibiotic, which can induce voltage-gated conductance in…
Alamethicin F 50 is an antibiotic. Alamethicin F 50 consists of membrane-active peptides containing 75% Alamethicin F 50/5 and 10% Alamethicin F 50/7. Alamethicin F 50 exhibits antifungal and antibacterial activity by disrupting the integrity of microbial cell membranes, leading to leakage of cellular contents and microbial death. Alamethicin F 50 can reduce the surface…
Alloferon 1 is an antiviral and anti-tumor peptide. Alloferon 1 stimulates the natural cytotoxicity of human peripheral blood lymphocytes. Alloferon 1 also induces IFN synthesis and enhances antiviral and anti-tumor resistance in mice. Alloferon 1 also shows anti-inflammatory activity in a ??-carrageenan-induced paw edema model. Alloferon 1 can be isolated from the hemolymph of Calliphora…
Alloferon 2 is an antiviral and anti-tumor peptide. Alloferon 2 can be isolated from the hemolymph of Calliphora vicina (Diptera). Product Details Product Name Alloferon 2 Biological activity Alloferon 2 is an antiviral and antitumoral peptide. Alloferon 2 can be isolated from the blood of the blow fly Calliphora vicina (Diptera). Sequence Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly Sequence Shortening…
Alytesin is a bombesin-like peptide present in the skin extract of Alytes obstetricans. Alytesin reduces gastric acid secretion and induces hypertension. Alytesin also produces a short-term anorectic effect in newborn chicks. Product Details Product Name Alytesin Biological activity Alytesin, a bombesin-like peptide, is found in extracts of the skin of Alytes obstetricans. Alytesin reduces gastric…
Aminocandin (HMR 3270) is a water-soluble echinocandin antifungal agent with good activity against Aspergillus and Candida spp. Product Details Product Name Aminocandin Biological activity Aminocandin (HMR 3270) is water-soluble antifungal agent of the echinocandin class with excellent activity against Aspergillus and Candida spp.. Molecular Weight 1102.28 Formula C56H79N9O14 CAS Number 227472-48-2 Storage Please store the…
Amp1EP9 is an antimicrobial peptide. Amp1EP9 is a powerful tool for developing effective and non-toxic antibacterial active molecules. Amp1EP9 has potential for research on multidrug-resistant bacterial infections. Product Details Product Name Amp1EP9 Biological activity Amp1EP9 is an antimicrobial peptide. Amp1EP9 is a powerful tool for developing potent and nontoxic antimicrobial agents. Amp1EP9 has the potential…
Amphomycin is a lipopeptide antibiotic that inhibits peptidoglycan synthesis and blocks cell wall development. Amphomycin exhibits potent antibacterial activity against methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant Enterococci (VRE), penicillin-gentamicin-erythromycin-resistant Streptococcus pneumoniae, and linezolid-quinupristin-dalfopristin-resistant Enterococci. Product Details Product Name Amphomycin Biological activity Amphomycin is a lipopeptide antibiotic that inhibits peptidoglycan synthesis and blocks cell wall development. Amphomycin…
AMPR-22 is an antimicrobial peptide. AMPR-22 can bind to bacterial membranes and induce membrane permeabilization. AMPR-22 is effective against a mouse model of sepsis induced by MDR strains. Product Details Product Name AMPR-22 Biological activity AMPR-22 is an antimicrobial peptide. AMPR-22 can bind to the bacterial membrane and induces membrane permeabilization. AMPR-22 is effective against…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Antimicrobial Peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us