Insert HTML here
Showing 1185–1200 of 3705 results
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Ultra Peptide Pools Condition / Topic: Dengue fever, Infection, Sequence diversity Layout: Freeze-dried in glass vial Organism: Dengue virus Protein Name: Envelope protein Purity: Development Grade: each peptide purified to…
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Dengue fever Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Dengue virus Protein Name: Genome polyprotein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GTSGSPIADK-OH Specifications: 10mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Dependoparvovirus primate1 Protein Name: Capsid protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-NSLANPGIA-OH Specifications: 9mer peptide as TFA salt
Depreotide is a nove tumor tarcer, can be complexed with technetium-99m (99mTc-depreotide) for optimal imaging properties. 99mTc-depreotide somatostain receptor imaging has been playing an important role in medical diagnosis research. Depreotide can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs). Product Information Product Name Depreotide Molecular Weight 1357.69 Formula C65H96N16O12S2 CAS Number 161982-62-3
Dermaseptin is a polypeptide isolated from frog skin that exhibits potent antimicrobial activity against bacteria, fungi, and protozoa. Product Details Product Name Dermaseptin Biological activity Dermaseptin, a peptide isolated from frog skin, exhibits potent antimicrobial activity against?bacteria,?fungi, and protozoa?at micromolar concentration. CAS Number 136212-91-4 Appearance Solid Color White to off-white Sequence Ala-Leu-Trp-Lys-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asp-Thr-Ile-Ser-Gln-Gly-Thr-Gln Sequence Shortening ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ
Dermaseptin TFA is a peptide isolated from frog skin that exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentrations. Product Details Product Name Dermaseptin TFA Biological activity Dermaseptin TFA, a peptide isolated from frog skin, exhibits potent antimicrobial activity against?bacteria,?fungi, and?protozoa?at micromolar concentration. Appearance Solid Color White to off-white Sequence Ala-Leu-Trp-Lys-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asp-Thr-Ile-Ser-Gln-Gly-Thr-Gln Sequence…
Dermaseptin-B3 inhibits the growth of Gram-positive and Gram-negative bacteria (with MICs of 1.3, 2.3, 5.0, 2.6, and 2.3 ??M against S. aureus, P. aeruginosa, P. aeruginosa, E. coli (ATCC 25922), and E. coli (54127), respectively). Dermaseptin-B3 also inhibits tumor cell proliferation. Product Details Product Name Dermaseptin-B3 Biological activity Dermaseptin-B3 inhibits the growth of Gram-positive and…
Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor. Product Details Product Name Dermaseptin-B4 Biological activity Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor. Sequence Ala-Leu-Trp-Lys-Thr-Ile-Ile-Lys-Gly-Ala-Gly-Lys-Met-Ile-Gly-Ser-Leu-Ala-Lys-Asn-Leu-Leu-Gly-Ser-Gln-Ala-Gln-Pro-Glu-Ser-NH2 Sequence Shortening ALWKDILKNVGKAAGKAVLNTVTDMVNQ-NH2 Storage Please store the product under the recommended conditions…
Dermaseptin-B5 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor. Product Details Product Name Dermaseptin-B5 Biological activity Dermaseptin-B5 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor. Sequence Gly-Leu-Trp-Asn-Lys-Ile-Lys-Glu-Ala-Ala-Ser-Lys-Ala-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Phe-Val-Asn-Glu-Met-Val-NH2 Sequence Shortening GLWNKIKEAASKAAGKAALGFVNEMV-NH2 Storage Please store the product under the recommended conditions…
Dermaseptin-B9 is an antimicrobial peptide isolated from frogs of the subfamily Phyllomedusinae. Product Details Product Name Dermaseptin-B9 Biological activity Dermaseptin-B9 is an antimicrobial peptide isolated from frogs of the Phyllomedusinae subfamily. Sequence Ala-Leu-Trp-Lys-Thr-Ile-Ile-Lys-Gly-Ala-Gly-Lys-Met-Ile-Gly-Ser-Leu-Ala-Lys-Asn-Leu-Leu-Gly-Ser-Gln-Ala-Gln-Pro-Glu-Ser Sequence Shortening ALWKTIIKGAGKMIGSLAKNLLGSQAQPES Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dermaseptin-S1 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S1 Biological activity Dermaseptin-S1 is an antimicrobial peptide derived from frog skin against filamentous fungi. Appearance Solid Color White to off-white Sequence Ala-Leu-Trp-Lys-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asp-Thr-Ile-Ser-Gln-Gly-Thr-Gln Sequence Shortening ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ Storage Sealed storage, away from moisture
Dermaseptin-S2 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S2 Biological activity Dermaseptin-S2 is an antimicrobial peptide derived from frog skin against filamentous fungi. Sequence Ala-Leu-Trp-Phe-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asn-Thr-Ile-Ser-Gln-Gly-Thr-Gln Sequence Shortening ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dermaseptin-S3 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S3 Biological activity Dermaseptin-S3 is an antimicrobial peptide derived from frog skin against filamentous fungi. Sequence Ala-Leu-Trp-Lys-Asn-Met-Leu-Lys-Gly-Ile-Gly-Lys-Leu-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Val-Lys-Lys-Leu-Val-Gly-Ala-Glu-Ser Sequence Shortening ALWKNMLKGIGKLAGKAALGAVKKLVGAES Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dermaseptin-S4 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S4 Biological activity Dermaseptin-S4 is an antimicrobial peptide derived from frog skin against filamentous fungi. Sequence Ala-Leu-Trp-Met-Thr-Leu-Leu-Lys-Lys-Val-Leu-Lys-Ala-Ala-Ala-Lys-Ala-Ala-Leu-Asn-Ala-Val-Leu-Val-Gly-Ala-Asn-Ala Sequence Shortening ALWMTLLKKVLKAAAKAALNAVLVGANA Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dermaseptin-S5 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S5 Biological activity Dermaseptin-S5 is an antimicrobial peptide derived from frog skin against filamentous fungi. Sequence Gly-Leu-Trp-Ser-Lys-Ile-Lys-Thr-Ala-Gly-Lys-Ser-Val-Ala-Lys-Ala-Ala-Ala-Lys-Ala-Ala-Val-Lys-Ala-Val-Thr-Asn-Ala-Val Sequence Shortening GLWSKIKTAGKSVAKAAAKAAVKAVTNAV Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dermcidin-1L (human) is an antibacterial and antifungal peptide. Dermcidin-1L (human) can be derived from the C-terminal region of full-length dermcidin. Dermcidin-1L (human) has potent bactericidal activity against E. coli, E. faecalis, and S. aureus, and fungicidal activity against C. albicans. Dermcidin-1L (human) can be used in research related to bacterial and fungal skin infections. Product…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us