Copeptin (human)
Description
Copeptin (human) is a peptide biochemical reagent corresponding to the 39 amino acid sequence at the C-terminus of human pre-provasopressin, which serves as a stable surrogate biomarker reflecting the secretion of arginine vasopressin (AVP). Copeptin (human) can be used in studies related to AVP secretion, fluid and osmotic homeostasis, stress responses, and cardiovascular biomarkers.
Product Information
| Product Name | Copeptin (human) |
| Molecular Weight | 4021.40 |
| Formula | C177H279N49O58 |
| CAS Number | 78362-34-2 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr |
| Sequence Shortening | ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
| Storage | Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture) ???? & ??Ʒ???? ???ȣ? 98.39% ѡ?????Σ? HY-P5007-13***** Data Sheet (527 KB) SDS (252 KB) COA (281 KB)RP-HPLC (88 KB)MS (499 KB) ??Ʒʹ??ָ?? (1538 KB) ?ο????? . Mu D, et al. Copeptin as a Diagnostic and Prognostic Biomarker in Cardiovascular Diseases. Frontiers in cardiovascular medicine. 2022;9:901990. ? . Makwana R, et al. Copeptin, a surrogate marker of arginine vasopressin, has no ability to modulate human and mouse gastric motility. European journal of pharmacology. 2021 Feb 05;892:173740. ? . Morgenthaler NG, et al. Assay for the measurement of copeptin, a stable peptide derived from the precursor of vasopressin. Clinical chemistry. 2006 Jan;52(1):112-9. ? |
