Insert HTML here
Showing 3617–3632 of 3705 results
Tyrosylleucine (Tyr-Leu, YL) TFA, an orally active dipeptide, exhibits a potent antidepressant-like activity. Product Information Product Name Tyrosylleucine TFA Molecular Weight 408.37 Formula C17H23F3N2O6 CAS Number 66852-01-5 Appearance Solid Color White to off-white Sequence Tyr-Leu Sequence Shortening YL Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C,…
Ubiquicidin (29-41) (UBI(29-41)) is an antimicrobial peptide and infection-localizing agent. Ubiquicidin (29-41) can serve as an infection-specific imaging agent and infection-targeting agent. Ubiquicidin (29-41) can serve as an antibiotic efficacy monitoring agent, with higher accumulation levels in Staphylococcus aureus-induced infections than in Escherichia coli-induced infections. Product Details Product Name Ubiquicidin(29-41) Biological activity Ubiquicidin (29-41) (UBI…
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure. Product Information Product Name Ularitide Molecular Weight 3505.96 Formula C145H234N52O44S3 CAS Number 118812-69-4 Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys11-Cys27) Sequence Shortening TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge:Cys11-Cys27)
Unguisin A is a cyclic peptide that can be isolated from the marine-derived fungus Emericella unguis. Product Details Product Name Unguisin A Biological activity Unguisin A s a cyclic peptides that can be isolated from the marine-derived fungus Emericella unguis. Sequence Cyclo(Ala-Trp-{Oaa}-Ala-Val-Leu-Val) Sequence Shortening Cyclo(AW-{Oaa}-AVFV) Storage Please store the product under the recommended conditions in…
Unguisin B is a cyclic peptide that can be isolated from the marine-derived fungus Emericella unguis. Product Details Product Name Unguisin B Biological activity Unguisin B s a cyclic peptides that can be isolated from the marine-derived fungus Emericella unguis. Sequence Cyclo(Ala-Trp-{Oaa}-Ala-Val-Leu-Val) Sequence Shortening Cyclo(AW-{Oaa}-AVLV) Storage Please store the product under the recommended conditions in…
Urcosimod (OK 101) is a lipid-coupled chemokine peptide, a ChemR23 G protein-coupled receptor agonist, which has been shown to have anti-inflammatory and analgesic activities. Urcosimod can be used for dry eye research. Product Information Product Name Urcosimod Molecular Weight 1994.37 Formula C101H152N14O27 CAS Number 1610366-43-2 Appearance Solid Color White to off-white Sequence {(C16 acid-PEG8)-Gly}-Gly-{dTyr}-Phe-Leu-Pro-{dSer}-Gln-Phe-{dAla}-{L-Porretine}-Ser Sequence…
Product Name Urechistachykinin I Biological activity Urechistachykinin I (Uru-TK I), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect. CAS Number 149097-03-0 Sequence Sequence Leu-Arg-Gln-Ser-Gln-Phe-Val-Gly-Ser-Arg-NH2 Sequence Shortening Sequence Shortening LRQSQFVGSR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Angiotensin I/II (1-6) Biological activity Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment,…
Product Name Urechistachykinin II Biological activity Urechistachykinin II (Uru-TK II), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect. CAS Number 149097-04-1 Sequence Sequence Ala-Ala-Gly-Met-Gly-Phe-Phe-Gly-Ala-Arg-NH2 Sequence Shortening Sequence Shortening AAGMGFFGAR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Urechistachykinin I Biological activity Urechistachykinin I (Uru-TK I), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect. CAS Number 149097-03-0 Sequence Sequence Leu-Arg-Gln-Ser-Gln-Phe-Val-Gly-Ser-Arg-NH2 Sequence Shortening Sequence Shortening LRQSQFVGSR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Urocortin II, human is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. Urocortin II, human has an effect of promoting satiet and neuroprotective effect. Urocortin II, human also has bactericidal, antiparasitic and pro-inflammation activity. Urocortin II, human can activate NF-??B pathway and ERK1/2 MAP kinase. Urocortin II, human can reduce pulmonary arterial…
Urocortin II, human acetate is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. Urocortin II, human acetate has an effect of promoting satiet and neuroprotective effect. Urocortin II, human acetate also has bactericidal, antiparasitic and pro-inflammation activity. Urocortin II, human acetate can activate NF-??B pathway and ERK1/2 MAP kinase. Urocortin II, human…
Urocortin II, human TFA is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. Urocortin II, human TFA has an effect of promoting satiet and neuroprotective effect. Urocortin II, human TFA also has bactericidal, antiparasitic and pro-inflammation activity. Urocortin II, human TFA can activate NF-??B pathway and ERK1/2 MAP kinase. Urocortin II, human…
Product Name [Ala18] Endothelin-1, human Biological activity Endothelin-1, human is a biologically active peptide. Endothelin-1, human can be used for the research of various biochemical studies. Sequence Shortening Sequence Shortening CSCSSLMDKECVYFCHLAIIW Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Proinsulin C-Peptide (55-89), human Biological activity Proinsulin C-Peptide (55-89), human is a peptide fragment of the cleavage product of proinsulin. CAS Number 11097-48-6 Appearance Solid Color White to off-white Sequence Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg Sequence Shortening Sequence Shortening RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR Storage Sealed storage, away from moisture and light, under nitrogen Powder -80??C 2 years -20??C 1…
Product Name Neuromedin U, rat TFA Biological activity Neuromedin U, rat TFA is a 23-amino acid brain-gut peptide. Neuromedin U (NMU), through its cognate receptor NMUR2 in the central nervous system, regulates several important physiological functions, including energy balance, stress response, and nociception. Appearance Solid Color White to off-white Sequence Sequence Tyr-Lys-Val-Asn-Glu-Tyr-Gln-Gly-Pro-Val-Ala-Pro-Ser-Gly-Gly-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 Sequence Shortening Sequence…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us