Vapreotide acetate (RC-160 acetate; BMY-41606 acetate) is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM. Product Information Product Name Vapreotide acetate Molecular Weight 1191.42 Formula C59H74N12O11S2 CAS Number 849479-74-9 Appearance Solid Color White to off-white Sequence {d-Phe}-Cys-Tyr-{d-Trp}-Lys-Val-Cys-Trp-NH2 (Disulfide bridge: Cys2-Cys7) Sequence Shortening {d-Phe}-CY-{d-Trp}-KVCW-NH2 (Disulfide bridge: Cys2-Cys7) Storage Sealed storage, away from moisture…
Vapreotide diacetate is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM. Product Information Product Name Vapreotide diacetate Molecular Weight 1251.47 Formula C61H78N12O13S2 CAS Number 936560-75-7 Sequence {d-Phe}-Cys-Tyr-{d-Trp}-Lys-Val-Cys-Trp-NH2 (Disulfide bridge: Cys2-Cys7) Sequence Shortening {d-Phe}-CY-{d-Trp}-KVCW-NH2 (Disulfide bridge: Cys2-Cys7)
Product Name KEMPFPKYPVEP Biological activity KEMPFPKYPVEP is a 12-amino acids neuropeptide, which upregulates levels of dopamine (DA) and norepinephrine (NE) in the prefrontal cortex, exhibits spatial and object recognition memory promoting ability in Scopolamine (HY-N0296)-induced amnesia mouse model. CAS Number 1393589-51-9 Sequence Sequence Lys-Glu-Met-Pro-Phe-Pro-Lys-Tyr-Pro-Val-Glu-Pro Sequence Shortening Sequence Shortening KEMPFPKYPVEP Storage Please store the product under…
Veldoreotide (DG3173) a somatostatin analogue, binds to and activate the somatostatin receptors (SSTR) 2, 4, and 5. Veldoreotide inhibits growth hormone (GH) secretion in adenomas compared withOctreotide (HY-P0036). Veldoreotide has the potential to be used as pain modulating agent Product Information Product Name Veldoreotide Molecular Weight 1123.30 Formula C60H74N12O10 CAS Number 252845-37-7
Velmupressin (c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2) is a potent, selective and short-acting peptidic V2 receptor (V2R) agonist with EC50s of 0.07 and 0.02 nM for hV2R and rV2R, respectively. Product Information Product Name Velmupressin Molecular Weight 946.58 Formula C42H60ClN11O8S2 CAS Number 1647119-61-6
Velmupressin (c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2) acetate is a potent, selective and short-acting peptidic V2 receptor (V2R) agonist with EC50s of 0.07 and 0.02 nM for hV2R and rV2R, respectively. Product Information Product Name Velmupressin acetate Molecular Weight 1006.63 Formula C44H64ClN11O10S2 CAS Number 1647120-04-4 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture Powder -80??C 2…
Vensemaglutide is the agonist for glucagon-like peptide 1 (GLP-1) receptor. Vensemaglutide can be used in research of diabetes or other metabolic disorders. Product Information Product Name Vensemaglutide Molecular Weight 4668.25 Formula C214H337N49O67 CAS Number 2919344-88-8 Sequence Gly-Gly(C2-NH2-γGlu-C16 acid)-His-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(γGlu-AEEA-AEEA-C18 diacid)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly Sequence Shortening G-Gly(C2-NH2-γGlu-C16 acid)-H-{Aib}-EGTFTSDVSSYLEGQAA-Lys(γGlu-AEEA-AEEA-C18 diacid)-EFIAWLVRGRG
Ventegatide is an integrin-binding peptide that can be used for the study of osteoarthritis. Product Information Product Name Ventegatide Molecular Weight 2537.61 Formula C107H161N31O41 CAS Number 478496-41-2 Sequence Thr-Asp-Leu-Gln-Glu-Arg-Gly-Asp-Asn-Asp-Ile-Ser-Pro-Phe-Ser-Gly-Asp-Gly-Gln-Pro-Phe-Lys-Asp-NH2 Sequence Shortening TDLQERGDNDISPFSGDGQPFKD-NH2
Vezocolmitide (ST-100) is a collagen mimetic peptide. Vezocolmitide can rapidly repair damaged collagen triple helix structures, thereby quickly reversing damage to the ocular surface and extracellular matrix, and restoring corneal nerve function while repairing the epithelium. Vezocolmitide can be used for research of dry eye disease (DED). Product Information Product Name Vezocolmitide Molecular Weight 1776.99…
Vicatertide (SB-01, Peniel 2000) is a polypeptide with both competitive inhibitory activity against TGF-β1 and selective inhibitory activity against human factor XIa (hFXIa, with a Ka of 80 nM for hFXIa). Vicatertide binds allosterically to the two binding sites of dimeric hFXI/hFXIa, while directly binding to activated TGF-β1, selectively blocking the Smad1/5/8 pathway and maintaining…
Product Name Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled Biological activity Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research. CAS Number 1815618-06-4 Appearance Solid Color White to off-white Sequence Sequence…
Product Name Nocistatin(human) Biological activity Nocistatin (human) blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2. Formula Formula C149H238N42O53S3 CAS Number 212609-11-5 Sequence Sequence Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln Sequence Shortening Sequence Shortening MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
VIR-165 is a modified form of the viral inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its entry into target membranes. VIRIP inhibits a variety of human immunodeficiency virus type 1 (HIV-1) strains. Product Details Product Name VIR-165 Biological activity VIR-165 is a modified form of virus inhibitory peptide…
Virgilagicin is a Gram-positive-active antibiotic with a dual polyprenyl phosphate binding mechanism that prevents the development of resistance. Product Details Product Name Virgilagicin Biological activity Virgilagicin is a Gram-positive active antibiotic that has a dual polyprenyl phosphate binding mechanism that impedes resistance development. Storage Please store the product under the recommended conditions in the Certificate…
Vorumotide is an immunological agent for active immunization as well as an antineoplastic agent. Product Information Product Name Vorumotide Molecular Weight 2626.03 Formula C114H181N39O29S2 CAS Number 935395-34-9 Sequence Pro-Gly-Cys-Asn-Lys-Arg-Tyr-Phe-Lys-Leu-Ser-His-Leu-Gln-Met-His-Ser-Arg-Lys-His-Thr-Gly Sequence Shortening PGCNKRYFKLSHLQMHSRKHTG
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research. Product Information Product Name Vosoritide Molecular Weight 4102.73 Formula C176H290N56O51S3 CAS Number 1480724-61-5 Appearance Solid…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
