Proadrenomedullin (1-20) (rat)

Description

Product Name	pTH (1-84) (dog)
Biological activity	pTH (1-84) dog is a biologically active full-length canine parathyroid hormone, as well as an agonist of PTHR. pTH (1-84) dog can be detected by the “intact” PTH (W-PTH) assay, thus effectively distinguishing inactive C-terminal fragments. In terms of metabolic regulation, it rapidly and persistently stimulates hepatic glucose release, hepatic alanine uptake, and alanine-based gluconeogenesis in conscious fasted dogs, and causes a secondary increase in circulating canine insulin levels due to enhanced glucose release. However, high doses of pTH (1-84) (dog) may induce adverse reactions such as hypercalcemia in dogs. Based on the above characteristics, this hormone can be widely used in studies related to canine hyperadrenocorticism (HAC).
Molecular Weight	9470.64
Formula	Formula C414H672N122O128S2
CAS Number	521986-14-1
Sequence	Sequence Ser-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Ile-Ala-His-Arg-Asp-Gly-Ser-Ser-Gln-Arg-Pro-Leu-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-Tyr-Gln-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asp-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln
Sequence Shortening	Sequence Shortening SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.