Insert HTML here
Showing 3073–3088 of 3705 results
Omramotide is an immunological agent for active immunization (antineoplastic). Product Information Product Name Omramotide Molecular Weight 1149.42 Formula C62H88N10O11 CAS Number 2306406-71-1 Sequence Phe-Leu-Pro-Phe-Gly-Phe-Ile-Leu-Pro-Val Sequence Shortening FLPFGFILPV
Onc112 is a proline-rich antimicrobial peptide with potent activity against Gram-negative bacteria. Onc112 inhibits translation by blocking and destabilizing the initiation complex. Product Details Product Name Onc112 Biological activity Onc112 is a proline-rich antimicrobial peptide that displays potent activity against Gram-negative bacteria. Onc112 inhibits translation by blocking and destabilizing the initiation complex. Appearance Solid Color…
oNCM is an antibacterial peptide. oNCM has good antibacterial activity, anti-biofilm capacity, anti-inflammatory effects, high stability, and low cytotoxicity. oNCM can be used in research on infectious or inflammatory diseases. Product Details Product Name oNCM Biological activity oNCM is an antibacterial peptide. oNCM has good antibacterial activity, anti biofilm ability, anti-inflammatory effect, high stability, and…
Oncocin is an antibacterial peptide. It belongs to the proline-rich antimicrobial peptides (PrAMPs). Oncocin is active against Gram-negative bacteria, with minimum inhibitory concentrations (MICs) of 0.125-8 ??g/mL against clinical isolates and strains of 34 Enterobacteriaceae and non-fermenting bacteria. Oncocin binds to the substrate-binding domain of the chaperone protein DnaK. The dissociation constant of this binding…
Product Name [Glu4]-Oxytocin acetate Biological activity -Oxytocin acetate is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of oxytocin-like molecules in aqueous solution. Appearance Solid Color White to off-white Sequence Sequence Cys-Tyr-Ile-Glu-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge:Cys1-Cys6) Sequence Shortening Sequence Shortening CYIENCPLG-NH2 (Disulfide bridge:Cys1-Cys6) Storage Sealed storage, away…
Onzigolide (BIM-23A760), a chimeric dopamine-somatostatin compound, shows potent agonist activity at both DA type 2 (D2R) and SST type 2 (SSTR2) receptors. Product Information Product Name Onzigolide Molecular Weight 1694.20 Formula C86H116N16O12S4 CAS Number 778630-77-6
OP-145 is an antimicrobial peptide LL-37 derivative and an antimicrobial peptide with antibacterial activity against a variety of MRSA strains. OP-145 can be used in research on chronic suppurative otitis media. Product Details Product Name OP-145 Biological activity OP-145, an cathelicidin LL-37 derivative, is an antimicrobial peptide, and shows antibacterial activity against several MRSA strains….
Amount: 5 mg Application: Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-MDYKDHDGDYKDHDIDYKDDDDK-OH Specifications:
Product Name C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse Biological activity C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse is an activator of particulate guanylate cyclase B (pGC-B), which is highly expressed in endothelial cells, kidneys, and the heart. C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse can mediate a potent anti-fibrotic effect in human cardiac and renal…
Product Name Orexin A (16-33) Biological activity Orexin A (16-33) is a fragment of orexin A. CAS Number 1374694-00-4 Sequence Sequence Leu-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH2 Sequence Shortening Sequence Shortening LYELLHGAGNHAAGILTL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) Biological activity Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) (Human PTHrP (107-111) amide) is a C-terminal parathyroid hormone-related protein fragment that can inhibit bone resorption. CAS Number 155918-12-0 Sequence Sequence Thr-Arg-Ser-Ala-Trp-NH2 Sequence Shortening Sequence Shortening TRSAW-NH2 Storage Please store the…
Product Name GLP-1(7-36), amide Biological activity GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion. Molecular Weight 3297.68 Formula Formula C149H226N40O45 CAS Number 107444-51-9 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Product Name GIP (1-30) amide,human acetate Biological activity GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human acetate dose-dependently promotes insulin secretion over the range 10-9-10-6 M. Formula Formula C164H244N40O49S Appearance Solid Color White to off-white…
Product Name Calcitonin (rat) Biological activity Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 11118-25-5…
Product Name β-Casomorphin, human Biological activity is an opioid peptide, acts as an agonist of opioid receptor. Molecular Weight 864 Formula Formula C44H61N7O11 CAS Number 102029-74-3 Sequence Sequence Tyr-Pro-Phe-Val-Glu-Pro-Ile Sequence Shortening Sequence Shortening YPFVEPI Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neurokinin B TFA Biological activity Neurokinin B TFA is a tachykinin family peptide that preferentially binds to and activates NK3R over other tachykinin receptors. Neurokinin B TFA preferentially binds to the substance P receptor (SP-N receptor) and mediates acetylcholine release from cholinergic neurons. Neurokinin B TFA regulates the pulsatile release of Kisspeptin and…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us