Palicourein
Description
Palicourein is a 37-amino-acid cyclic polypeptide that inhibits the cytopathic effect of HIV-1RF infection in CEM-SS cells in vitro, with an EC50 value of 0.1 ??M and an IC50 value of 1.5 ??M.
Product Details
| Product Name | Palicourein |
| Biological activity | Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 ??M and an IC50 value of 1.5 ??M. |
| CAS Number | 331714-57-9 |
| Sequence | Cyclo(Gly-Asp-Pro-Thr-Phe-Cys-Gly-Glu-Thr-Cys-Arg-Val-Ile-Pro-Val-Cys-Thr-Tyr-Ser-Ala-Ala-Leu-Gly-Cys-Thr-Cys-Asp-Asp-Arg-Ser-Asp-Gly-Leu-Cys-Lys-Arg-Asn) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6) |
| Sequence Shortening | Cyclo(GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6) |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
