Palopegteriparatide
Description
Palopegteriparatide (Transcon PTH; ACP-014) is a prodrug of parathyroid hormone PTH(1-34), which can maintain normal and stable calcium concentrations without the need for calcium and active vitamin D replacement. Palopegteriparatide can be used in research on hypoparathyroidism.
Product Information
| Product Name | Palopegteriparatide |
| CAS Number | 2222514-07-8 |
| Sequence | {X}-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe (X= O-methylpolyethylene glycol (2 x 20 kDa mPEG)-Aib) |
| Sequence Shortening | {X}-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (X= O-methylpolyethylene glycol (2 x 20 kDa mPEG)-Aib) |
