Product Name Oxyntomodulin (human, mouse, rat) Biological activity Oxyntomodulin (human, mouse, rat) (Proglucagon (33-69)) is a product of the glucagon precursor. Oxyntomodulin (human, mouse, rat) contains the entire glucagon sequence plus a C-terminal octapeptide, comprising in total 37 amino acids. CAS Number 159002-68-3 Appearance Solid Color White to off-white Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala Sequence Shortening Sequence…
Product Name Glucagon-like peptide 1 (1-37), human Biological activity Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor. Molecular Weight 4169.48 Formula Formula C186H275N51O59 CAS Number 87805-34-3 Appearance Solid Color White to off-white Sequence Sequence His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Product Name Ac-[Nle4,D-Phe7]-α-MSH (4-10)-NH2 Biological activity Ac–α-MSH (4-10)-NH2 is a melanotropin, a melanocyte-stimulating hormone. Ac–α-MSH (4-10)-NH2 stimulates tyrosinase and exhibits thermoregulatory effect in rats model. Molecular Weight 985.1 Formula Formula C47H64N14O10 CAS Number 82188-67-8 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening Ac-{Nle}-EH-{d-Phe}-RWG-NH2 Storage Sealed storage, away from moisture and light Powder -80??C…
Product Name GeX-2 Biological activity GeX-2 is a truncated analogue of αO-conotoxin. GeX-2 activates GABAB receptor. GeX-2 inhibits α9α10 nAChR and CaV2.2 channels. GeX-2 alleviates pain in the rat model of chronic constriction injury. CAS Number 2900996-95-2 Sequence Sequence Gly-Arg-Tyr-Arg-Ser-Pro-Tyr-Asp-Arg-Arg-Arg-Arg-Tyr-Arg-Arg-Ile-Thr-Asp-NH2 Sequence Shortening Sequence Shortening GRYRSPYDRRRRYRRITD-NH2 Storage Please store the product under the recommended conditions in…
Ornipressin (POR-8) is a vasopressin agonist specific for the V1 receptor. Ornipressin can be used as a local vasoconstrictor. Ornipressin can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin has antidiuretic activity. Ornipressin decreases renal vascular resistance and increases renal blood flow in renal failure model. Product Information Product Name Ornipressin Molecular Weight 1042.19…
Ornipressin (POR-8) acetate is a potent vasoconstrictor, hemostatic and renal agent. Ornipressin acetate is a vasopressin agonist specific for the V1 receptor. Ornipressin acetate can be used as a local vasoconstrictor. Ornipressin acetate can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin acetate has antidiuretic activity. Ornipressin acetate decreases renal vascular resistance and increases…
Osteocalcin 30-43 Fragment is an osteocalcin fragment.Osteocalcin 30-43 Fragment is a serum marker of bone turnover. Product Information Product Name Osteocalcin 30-43 Fragment Molecular Weight 1663.74 Formula C73H106N20O25 Sequence Shortening DELADHIGFQEAYR Sequence Shortening DELADHIGFQEAYR
Product Name Acetyl angiotensinogen (1-14), human Biological activity Acetyl angiotensinogen (1-14), human is a synthetic peptide and N-terminal acetylated form of Angiotensinogen (1-14), human (HY-P1486). CAS Number 104180-27-0 Sequence Sequence Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn Sequence Shortening Sequence Shortening Ac-DRVYIHPFHLVIHN Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Breast cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Histones Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ALKRQGRTLYGFGG-OH Specifications: 14mer peptide as TFA salt
Product Name Galanin (1-19), human Biological activity Galanin (1-19), human is the 1-19 fragment of the human galanin. Galanin (GAL) is a widely distributed neuropeptide with diverse biological effects including modulation of hormone release, antinociception and modification of feeding behavior. CAS Number 136005-51-1 Appearance Solid Color White to off-white Sequence Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His Sequence Shortening Sequence…
Product Name (TYR34)-PTH (7-34) AMIDE (BOVINE) Biological activity (TYR34)-PTH (7-34) AMIDE (BOVINE) is a peptide derivative of Parathyroid Hormone (PTH). CAS Number 86292-93-5 Sequence Sequence Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Tyr-NH2 Sequence Shortening Sequence Shortening FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Preptin (rat) Biological activity Preptin, an osteogenic peptide product of the pancreatic beta-cell, corresponds to Asp69-Leu102 of pro-IGF-II. Formula Formula C181H268N48O51 CAS Number 315197-73-0 Sequence Sequence Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu Sequence Shortening Sequence Shortening DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name pTH (7-84) (human) Biological activity pTH (7-84) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
OV-1, sheep is an ??-helical antimicrobial ovispirin polypeptide derived from the sheep SMAP29 polypeptide, which inhibits a variety of drug-resistant strains, including mucoid and non-mucoid Pseudomonas aeruginosa. Product Details Product Name OV-1, sheep Biological activity OV-1, sheep is an alpha-helical antimicrobial ovispirin peptide derived from SMAP29 peptide (sheep), which inhibits several antibiotic-resistant bacterial strains including…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
