Insert HTML here
Showing 2673–2688 of 3705 results
Product Name Urocortin III (mouse) free acid Biological activity Urocortin III (mouse) (free acid) is a selective CRF2 receptor agonist (with high affinity for the CRF2 receptor). Urocortin III (mouse) (free acid) significantly inhibits gastric emptying without modifying colonic transit. Molecular Weight 4171.26 Formula Formula C186H311N51S2 Sequence Shortening Sequence Shortening FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI Storage Please store the…
Product Name CAP2b Biological activity CAP2b is a cardioacceleratory peptide that can be isolated from Drosophila. CAP2b stimulates tubule fluid secretion via cGMP-signaling pathway. CAS Number 170470-44-7 Sequence Sequence {pGlu}-Leu-Tyr-Ala-Phe-Pro-Arg-Val-NH2 Sequence Shortening Sequence Shortening {pGlu}-LYAFPRV-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
LS-BF1 is a stable, low-toxicity cationic antimicrobial peptide. LS-BF1 shows broad-spectrum antibacterial activity through a cell membrane disruption mechanism, including against challenging ESKAPE pathogens. LS-BF1 shows good in vivo bacterial clearance in mouse infection models. Product Details Product Name LS-BF1 Biological activity LS-BF1 is a stable and low toxic cationic antimicrobial peptide. LS-BF1 displays broad…
Lufefolastat Tetraxetan is a covalent conjugate of a PSMA-targeted peptide ligand and Tetraxetan (HY-W053583), a DOTA-class chelator. When labeled with 225Ac, Lufefolastat Tetraxetan is applicable to research on prostate-specific membrane antigen (PSMA)-positive metastatic prostate cancer. Product Information Product Name Lufefolastat Tetraxetan Molecular Weight 2174.48 Formula C102H164N16O35 CAS Number 2934667-10-2
Product Name Carassin Biological activity Carassin is a 21 amino acid tachykinin-related peptide, it can be isolated from the goldfish brain. Carassin has moderate affinity for rat tachykinin binding sites. CAS Number 133950-47-7 Sequence Shortening Sequence Shortening SPANAQITRKRHKINSFVGLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer, and anti-aging properties. Lunasin can be isolated from soybeans. Lunasin also has an epigenetic mechanism of action related to histone acetylation. Lunasin can be internalized into cells and inhibits the formation of oncospheres in cancer cells. Product Details Product Name Lunasin Biological activity Lunasin is a…
Product Name Neurotensin(8-13) Biological activity Neurotensin (8-13) is an active fragment of Neurotensin. Neurotensin(8-13) results in a decrease in cell-surface NT1 receptors (NTR1) density. Molecular Weight 816.99 Formula Formula C38H64N12O8 CAS Number 60482-95-3 Appearance Solid Color White to off-white Sequence Sequence Arg-Arg-Pro-Tyr-Ile-Leu Sequence Shortening Sequence Shortening RRPYIL
Product Name Angiotensinogen (1-14), human Biological activity Angiotensinogen (1-14), human is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides. Molecular Weight 1760.01 Formula Formula C83H122N24O19 CAS Number 104180-23-6 Appearance Solid Color White to off-white Sequence Sequence Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn Sequence Shortening Sequence Shortening DRVYIHPFHLVIHN
LVGRQLEEFL (mouse) can be named as G * peptide, corresponding to amino acids 113 to 122 in apolipoprotein J ( apoJ)}. LVGRQLEEFL (mouse) exhibits anti-inflammatory and anti-atherogenic properties. LVGRQLEEFL (mouse) can be added to an apoJ mimetic, to form HM-10/10 peptide, which is a mimetic peptide and a novel chimeric high density lipoprotein. HM-10/10 peptide…
LVTX-8 is a peptide toxin extracted from Lycosa vittata. LVTX-8 has potent anticancer and anti-metastatic activity against lung cancer, with strong cytotoxicity. LVTX-8 significantly induces apoptosis through the P53 hypoxia pathway and integrin signaling, and inhibits the proliferation, invasion, and migration of lung cancer cells. LVTX-8 significantly inhibits tumor growth and metastasis in A549/H460 xenograft…
LY 121019 is a semi-synthetic antifungal antibiotic with strong anti-Candida activity, with an MIC50 value of 0.625 ??g/mL. Product Details Product Name LY 121019 Biological activity LY 121019 is a semi-synthetic antifungal antibiotic with strong anticandida activity with MIC50 value of 0.625 ??g/mL. Storage Please store the product under the recommended conditions in the Certificate…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Lymphocytic choriomeningitis, Meningitis Layout: Freeze-dried in glass vial Organism: Lymphocytic choriomeningitis virus Protein Name: Membrane protein, Nucleocapsid protein Purity: >70% (HPLC-MS), Development Grade:…
Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacteria, including MDR strains (MIC: 8-32 ??g/mL against methicillin-resistant MRSA strains). Lynronne-1 reduces bacterial load in a mouse model of MRSA-infected wounds. Lynronne-1 is also effective against P. aeruginosa infection. Product Details Product Name Lynronne-1 Biological activity Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active…
Lynronne-2 is an antimicrobial peptide. Lynronne-2 is active against Gram-positive bacteria, including MDR strains (MIC: 32-256 ??g/mL against methicillin-resistant MRSA strains). Lynronne-2 is also effective against P. aeruginosa infection. Product Details Product Name Lynronne-2 Biological activity Lynronne-2 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 32-256 ??g/mL for methicillin-resistant…
Lynronne-3 is an antimicrobial peptide. Lynronne-3 is active against Gram-positive bacteria, including MDR strains (MIC: 32-128 ??g/mL against methicillin-resistant MRSA strains). Lynronne-3 is also effective against P. aeruginosa infection. Product Details Product Name Lynronne-3 Biological activity Lynronne-3 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 32-128 ??g/mL for methicillin-resistant…
Lys-Bradykinin (Kallidin (380-389) (human, porcine, bovine)) tetraacetate, a kind of kallidin and bradykinin receptor ligand, can be generated by kininogen protein through enzymatic cleavage by the protease kallikrein. Lys-Bradykinin tetraacetate, also a vasodilator, can widen blood vessels and increase blood flow. ys-Bradykinin stimulates net Na+ influx, and also the DNA synthesis. Lys-Bradykinin tetraacetate involves in…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us