Product Name Adrenocorticotropic Hormone (ACTH) (1-39), human acetate Biological activity Adrenocorticotropic Hormone (ACTH) (1-39), human acetate is a full length human adrenocorticotropic hormone. Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Lysipressin (Lysine vasopressin ; -Vasopressin ) is a neurohypophyseal nonapeptide with dual cardiovascular regulatory activities of peripheral pressor action and central hypotensive action, and it also regulates pain perception in the body. Lysipressin is an Oxytocin Receptor agonist, with a Ki value of 10.2 nM for porcine OT receptor. Lysipressin stimulates contraction of rabbit bladder…
Product Name Glucagon (19-29), human Biological activity Glucagon (19-29), human is a potent and efficient inhibitor of insulin secretion. Molecular Weight 1352.53 Formula Formula C61H89N15O18S CAS Number 64790-15-4 Appearance Solid Color White to off-white Sequence Sequence Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr Sequence Shortening Sequence Shortening AQDFVQWLMNT
Product Name Prolactin Releasing Peptide (1-31), human acetate Biological activity Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can…
Lysipressin acetate (Lysine vasopressin acetate; -Vasopressin acetate) is a neurohypophyseal nonapeptide with dual cardiovascular regulatory activities of peripheral pressor action and central hypotensive action, and it also regulates pain perception in the body. Lysipressin acetate is an Oxytocin Receptor agonist, with a Ki value of 10.2 nM for porcine OT receptor. Lysipressin acetate stimulates contraction…
LZ1 peptide is a pyruvate kinase inhibitor, antimicrobial agent, and antimalarial agent. LZ1 peptide reduces ATP production and inhibits Plasmodium falciparum. LZ1 peptide is active against Plasmodium berghei in mice, reducing parasitemia. LZ1 peptide shows good antimicrobial activity against pathogens associated with acne vulgaris. LZ1 peptide has anti-inflammatory effects. LZ1 peptide can be used in…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
