Insert HTML here
Showing 2641–2656 of 3705 results
LL-21 (LL-37 LLG) is a polypeptide that can be discovered by peptide screening. Peptide screening is a research tool that primarily collects active peptides through immunoassays. Peptide screening can be used in protein interaction, functional analysis, and antigen epitope screening, especially in the field of active molecule research and development. Product Details Product Name LL-21…
LL-25 is a fragment of LL-37 (HY-P1222) but lacks the immunomodulatory properties of LL-37. LL-25 has antifungal and anti-Candida activity. Product Details Product Name LL-25 Biological activity LL-25 is a fragment of LL-37 (HY-P1222) but devoid of the immunomodulatory properties of LL-37. LL-25 has antifungal and candidacidal activity. Sequence Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys Sequence Shortening LLGDFFRKSKEKIGKEFKRIVQRIK Storage Please…
LL-37 (37-1) is the reverse sequence of LL-37 (HY-P1222), with biological activity highly similar to that of LL-37. LL-37 (37-1) has bactericidal function and is a host defense peptide of the immune system. LL-37 (37-1) can interact with double-stranded RNA (dsRNA) to inhibit double-stranded RNA-induced production of thymic stromal lymphopoietin, CCL5/RANTES, CXCL10/IP-10, and CXCL8/IL-8, and…
LL-37 amide is a selective agonist of the formyl peptide receptor-like FPRL1 and effectively inhibits periodontal pathogens (ED99=8.5-8.7 ??g/mL). LL-37 amide mediates immune cell chemotaxis through activation of FPRL1, while exerting bactericidal effects by disrupting bacterial cell membrane integrity. It also modulates inflammatory responses (inhibiting the release of factors such as TNF-??) and promotes angiogenesis;…
LL-37 amide TFA is a selective agonist of the formyl peptide receptor-like FPRL1 and effectively inhibits periodontal pathogens (ED99=8.5-8.7 ??g/mL). LL-37 amide TFA mediates immune cell chemotaxis through activation of FPRL1, while exerting bactericidal effects by disrupting bacterial cell membrane integrity. It also modulates inflammatory responses (inhibiting the release of factors such as TNF-??) and…
LL-37 FK-13 is an antibacterial agent that inhibits Trichomonas vaginalis. LL-37 FK-13 has weak hemolytic activity against human erythrocytes and relatively low cytotoxicity against human fibroblasts. Product Details Product Name LL-37 FK-13 Biological activity LL-37 FK-13 is an antimicrobial agent, that inhibits Trichomonas vaginalis. LL-37 FK-13 exhibits slight hemolytic effects on human erythrocytes and low…
LL-37 FK-13 TFA is the TFA salt form of LL-37 FK-13 (HY-P4836). LL-37 FK-13 TFA is an antibacterial agent that inhibits Trichomonas vaginalis. LL-37 FK-13 TFA has weak hemolytic activity against human erythrocytes and weak cytotoxicity against human fibroblasts. Product Details Product Name LL-37 FK-13 TFA Biological activity LL-37 FK-13 TFA is the TFA salt…
LL-37 FKR is a C-terminal fragment of LL-37. LL-37 FKR plays an important role in antibacterial properties. Product Details Product Name LL-37 FKR Biological activity LL-37 FKR is the C-terminal fragment of LL-37. LL-37 FKR plays an important role in antibacterial performance. Sequence Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser Sequence Shortening FKRIVQRIKDFLRNLVPRTES Storage Please store the product under the recommended…
LL-37 GKE is an active domain of LL-37. LL-37 GKE has antibacterial activity and has potential applications in antibiotics. Product Details Product Name LL-37 GKE Biological activity LL-37 GKE is an active domain of LL-37. LL-37 GKE has antibacterial activity and has potential applications in antibiotics. Sequence Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg Sequence Shortening GKEFKRIVQRIKDFLRNLVPR Storage Please store the…
LL-37 KR20 is an LL-37 derivative. Product Details Product Name LL-37 KR20 Biological activity LL-37 KR20 is aLL 37 derivative. CAS Number 672333-78-7 Sequence Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser Sequence Shortening KRIVQRIKDFLRNLVPRTES Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Human Purity: >95% (HPLC-MS) Quantification: No Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH Specifications: Antimicrobial peptide
LL-37 RKS is an active fragment of LL-37. Product Details Product Name LL-37 RKS Biological activity LL-37 RKS is an active fragment of LL-37. Sequence Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser Sequence Shortening RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Storage Please store the product under the recommended conditions in the Certificate of Analysis.
LL-37 scrambled peptide is a scrambled rearrangement peptide of the cathelicidin antimicrobial peptide LL-37 and can be used as a negative control for LL-37 peptide research. Product Details Product Name LL-37 scrambled peptide Biological activity LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a…
LL-37 scrambled peptide acetate is a scrambled rearrangement peptide of the cathelicidin antimicrobial peptide LL-37 and can be used as a negative control for LL-37 peptide research. Product Details Product Name LL-37 scrambled peptide acetate Biological activity LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can…
LL-37 SKE is an active fragment of LL-37. Product Details Product Name LL-37 SKE Biological activity LL-37 SKE is an active fragment of LL-37. Sequence Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg Sequence Shortening SKEKIGKEFKRIVQRIKDFLR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
LL-37-Cys is LL-37 (HY-P1222) carrying a reduced cysteine residue at the C-terminus. Product Details Product Name LL-37-Cys Biological activity LL-37-Cys is a LL-37 (HY-P1222) with a C-terminal reduced cystein residue[. Sequence Shortening LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC Storage Please store the product under the recommended conditions in the Certificate of Analysis.
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us