Lunasin
Description
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer, and anti-aging properties. Lunasin can be isolated from soybeans. Lunasin also has an epigenetic mechanism of action related to histone acetylation. Lunasin can be internalized into cells and inhibits the formation of oncospheres in cancer cells.
Product Details
| Product Name | Lunasin |
| Biological activity | Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer and anti-aging properties. Lunasin can be isolated from soybean. Lunasin also has an epigenetic mechanism of action associated with histone acetylation. Lunasin can be internalized into cells and inhibit Oncosphere formation in cancer cells. |
| Formula | C204H321N65O78S3 |
| CAS Number | 496823-34-8 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp |
| Sequence Shortening | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
| Storage | Sealed storage, away from moisture |
