Insert HTML here
Showing 2625–2640 of 3705 results
Product Name LH-RH (4-10) Biological activity LH-RH (4-10) is a heptapeptide, one of major degradation products of luteinising-hormone releasing hormone (LHRH) via pituitary and hypothalamus. LH-RH (4-10) produced in macrophages and type II pneumocytes. Formula Formula C33H53N11O9 CAS Number 51776-33-1 Sequence Shortening Sequence Shortening SYGLRPG-NH2 Storage Please store the product under the recommended conditions in…
Product Name GHRF, bovine Biological activity GHRF, bovine (bGRF(1-44)-NH2) is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone (HY-N0583). Molecular Weight 5104.72 Formula Formula C220H366N72O66S CAS Number 88894-91-1 Sequence Shortening Sequence Shortening YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 Storage Please store the product under the recommended…
Product Name (Glu20)-Glucagon (1-29) (human, rat, porcine) Biological activity (Glu20)-Glucagon (1-29) (human, rat, porcine) is the deamidation product of glucagon. CAS Number 2022956-46-1 Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Glu-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr Sequence Shortening Sequence Shortening HSQGTFTSDYSKYLDSRRAEDFVQWLMNT Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Biotin-Gastrin-1, human (1-17) Biological activity Biotin-Gastrin-1, human (1-17) is a biological active peptide. (Biotin-labeled HY-P1097) CAS Number 663625-43-2 Appearance Solid Color White to off-white Sequence Sequence {Biotin-Glu}-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening {Biotin-Glu}-GPWLEEEEEAYGWMDF-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1…
Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KIADRFLLY-OH Specifications: 9mer peptide as TFA salt
Linaclotide is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation. Product Information Product Name Linaclotide Molecular Weight 1526.74 Formula C59H79N15O21S6 CAS Number 851199-59-2 Appearance Solid Color White to off-white Sequence Cys-Cys-Glu-Tyr-Cys-Cys-Asn-Pro-Ala-Cys-Thr-Gly-Cys-Tyr (disulfide bridge:Cys1-Cys6,Cys2-Cys10,Cys5-Cys13) Sequence Shortening CCEYCCNPACTGCY (disulfide bridge:Cys1-Cys6,Cys2-Cys10,Cys5-Cys13) Storage Sealed storage, away…
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation. Product Information Product Name Linaclotide acetate Molecular Weight 1586.79 Formula C61H83N15O23S6 CAS Number 851199-60-5 Appearance Solid Color White to off-white Sequence Cys-Cys-Glu-Tyr-Cys-Cys-Asn-Pro-Ala-Cys-Thr-Gly-Cys-Tyr (disulfide bridge: Cys1-Cys6; Cys2-Cys10; Cys5-Cys13) Sequence Shortening CCEYCCNPACTGCY (disulfide…
Linvixdutide is a glucagon and glucagon-like peptide 1 receptor (GLP-1R) agonist with anti-obesity effects. Product Information Product Name Linvixdutide Molecular Weight 4939.49 Formula C228H342N56O67 CAS Number 3056608-44-4 Sequence His-{Aib}-His-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ala-Lys-Arg-Ala-Gln-Glu-Phe-Ile-Glu-Trp-Leu-Leu-Gln-Ser-Gln-Gln-His-Glu-Ser-Pro-Pro-Pro{Lys(γGlu-C20 diacid)} Sequence Shortening H-{Aib}-HGTFTSDYSKYLDAKRAQEFIEWLLQSQQHESPPP{K(γGlu-C20 diacid)}
Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus. Product Information Product Name Liraglutide Molecular Weight 3751.20 Formula C172H265N43O51 CAS Number 204656-20-2 Appearance Solid Color White to off-white Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-{Lys(γGlu-C16 acid)}-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly Sequence Shortening HAEGTFTSDVSSYLEGQAA-{Lys(γGlu-C16 acid)}-EFIAWLVRGRG Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C…
Liraglutide acetate is the acetate form of Liraglutide (HY-P0014), a glucagon-like peptide-1 (GLP-1) receptor agonist studied in type 2 diabetes. Product Information Product Name Liraglutide acetate Molecular Weight 3751.20 (free base) Formula C172H265N43O51.xC2H4O2 CAS Number 1997361-86-0 Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-{Lys(γGlu-C16 acid)}-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly Sequence Shortening HAEGTFTSDVSSYLEGQAA-{Lys(γGlu-C16 acid)}-EFIAWLVRGRG
Amount: 1.0 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Diabetes Peptide Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-HAEGTFTSDVSSYLEGQAA-Lys(Palmitoyl-gammaGlu)-EFIAWLVRGRG-OH
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Listeriosis Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Listeria Protein Name: Probable protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KYGVSVQDI-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Listeria Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-NEKYAQAYPNVS-OH Specifications: 12mer peptide as TFA salt
Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide can inhibit oxidative stress, mitochondrial dysfunction and apoptosis. Lixisenatide can be used for the researches of inflammation, metabolic disease, neurological disease and cardiovascular disease, such as rheumatoid arthritis,…
Lixisenatide (Leu-13C6,15N) TFA is the 13C- and 15N-labeled Lixisenatide (HY-P0119). Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide can inhibit oxidative stress, mitochondrial dysfunction and apoptosis. Lixisenatide can be used for the researches of inflammation, metabolic…
Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide acetate inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide acetate can inhibit oxidative stress, mitochondrial dysfunction and apoptosis. Lixisenatide acetate can be used for the researches of inflammation, metabolic disease, neurological disease and cardiovascular disease,…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us