Product Name Neurogranin (48-76), human Biological activity Neurogranin (48-76), human is a dominant endogenous peptide in Alzheimer’s disease (AD) brain tissue. Neurogranin (48-76) is a potential biomarker for synaptic function in AD. Sequence Sequence Ser-Gly-Glu-Arg-Gly-Arg-Lys-Gly-Pro-Gly-Pro-Gly-Gly-Pro-Gly-Gly-Ala-Gly-Val-Ala-Arg-Gly-Gly-Ala-Gly-Gly-Gly-Pro-Ser Sequence Shortening Sequence Shortening SGERGRKGPGPGGPGGAGVARGGAGGGPS Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Speract Biological activity Speract, a sea urchin egg peptide that regulates sperm motility, also stimulates sperm mitochondrial metabolism. Formula Formula C38H57N11O14 CAS Number 76901-59-2 Sequence Sequence Gly-Phe-Asp-Leu-Asn-Gly-Gly-Gly-Val-Gly Sequence Shortening Sequence Shortening GFDLNGGGVG Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Secretin, canine Biological activity Secretin, canine is an endocrine hormone that stimulates the secretion of bicarbonate-rich pancreatic fluids. Secretin, canine can regulates gastric chief cell function and paracellular permeability in canine gastric monolayers by a Src kinase-dependent pathway. CAS Number 110786-77-1 Sequence Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 Sequence Shortening Sequence Shortening HSDGTFTSELSRLRESARLQRLLQGLV-NH2 Storage Please store the…
Product Name SDKPDMAEIEKFDKSK Biological activity SDKPDMAEIEKFDKSK is a peptide derived from thymosin β4 (Tβ4). Formula Formula C80H130N20O29S CAS Number 1339864-27-5 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening SDKPDMAEIEKFDKSK Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage,…
Product Name AWL 60 Biological activity AWL 60 is a compound with SP antagonist and weak opioid agonist properties, which can antagonize SP-agonists in vitro and attenuate the decrease in blood pressure caused by SP-agonists in vivo. CAS Number 140716-14-9 Sequence Sequence Tyr-Pro-{D-Phe}-Phe-{D-Phe}-{D-Trp}-Met-NH2 Sequence Shortening Sequence Shortening YP-{D-Phe}-F-{D-Phe}-{D-Trp}-M-NH2 Storage Please store the product under the…
Product Name Thymus peptide C Biological activity Thymus peptide C is a hormonal agent derived from the thymus glands of young calves, which works as a substitute for the physiological functions of the thymus. Appearance Solid Color White to off-white Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Des-threoninol-octreotide Biological activity Des-threoninol-octreotide (Compound 13) is a Somatostatin analog. Des-threoninol-octreotide inhibits cloned somatostatin receptors with IC50 values of 13.62 nM, 10.63 nM, 10.95 nM for mSSTR2b, rSSTR5 and hSSTR5, respectively. Formula Formula C45H57N9O9S2 CAS Number 160841-00-9 Sequence Sequence {d-Phe}-Cys-Phe-{d-Trp}-Lys-Thr-Cys (Disulfide bridge: Cys2-Cys7) Sequence Shortening Sequence Shortening {d-Phe}-CF-{d-Trp}-KTC (Disulfide bridge: Cys2-Cys7) Storage Please…
Product Name Isotocin Biological activity Isotocin is the homologue of mammalian oxytocin in teleost fish, belonging to the category of neurotransmitters/neuromodulators and peripheral hormones. Isotocin exerts biological effects by binding to its homologous isotocin receptor (with EC50 = 1.58e-10 mol/L in gilthead seabream) and specific G-protein-coupled receptor subtypes. Isotocin promotes paternal behavior in cichlids, regulates…
Product Name Urocortin, human Biological activity Urocortin, human, a 40-aa neuropeptide, acts as an agonist of endogenous CRF receptor, with Kis of 0.4, 0.3, and 0.5 nM for hCRF1, rCRF2α and mCRF2β, respectively. Molecular Weight 4696.24 Formula Formula C204H337N63O64 CAS Number 176591-49-4 Appearance Solid Color White to off-white Sequence Sequence Asp-Asn-Pro-Ser-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2 Sequence Shortening Sequence Shortening…
Product Name Secretin (swine) Biological activity Secretin (swine), a neuroendocrine hormone, is the first hormone to be identifie and is secreted by S cells that are localized primarily in the mucosa of the duodenum. Secretin also is a 27-amino acid peptide, which acts on secretin receptors. Secretin is expressed by cells in all mature enteroendocrine…
Product Name IGF-I (24-41) Biological activity IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) is amino acids 24 to 41 fragment of IGF-I. IGF-I, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I is partly responsible for systemic growth hormone (GH) activities. IGF-I has anabolic, antioxidant, anti-inflammatory and cytoprotective…
Product Name PACAP (1-38), amide, Biotin-labeled Biological activity PACAP (1-38), amide, Biotin-labeled is a biological active peptide. (Biotin-labeled HY-P0221) Appearance Solid Color White to off-white Sequence Sequence {Biotin}-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 Sequence Shortening Sequence Shortening {Biotin}-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C,…
Product Name Neuropeptide K (human, porcine, rat) Biological activity Neuropeptide K, human, porcine, rat exhibits bioactivity in gallbladder contraction, protein extravasation, hypotension and brcnchial smooth muscle spasm. Neuropeptide K, human, porcine, rat is concentrated in brain and acts as tachykinin neuromessenger. CAS Number 96827-05-3 Sequence Sequence Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2 Storage Please store…
Product Name Adrenocorticotropic hormone Biological activity Adrenocorticotropic hormone (ACTH; Adrenocorticotrophic hormone) is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone stimulates cortisol secretion from the adrenal cortex via the hypothalamic-pituitary-adrenal (HPA) axis. Adrenocorticotropic hormone regulates cortisol and androgen production. Adrenocorticotropic hormone can promote the development of spermatogenesis. Adrenocorticotropic hormone can relieve…
Product Name β-Endorphin (rat) Biological activity β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction. CAS Number 309246-19-3 Appearance Solid Color White to…
Product Name Angiotensinogen (1-13) (human) Biological activity Angiotensinogen (1-13) (human) is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides. CAS Number 82048-97-3 Sequence Sequence Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His Sequence Shortening Sequence Shortening DRVYIHPFHLVIH Storage Please store the product under the recommended conditions in the Certificate…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
