Neuropeptides

Product Name Adipokinetic hormone II (Locusta migratoria) Biological activity Adipokinetic hormone II (Locusta migratoria) (Lom-AKH-II) is a insect adipokinetic hormone (AKH), enhances fat body cAMP levels in vitro. Insect adipokinetic hormones (AKHs) controls flight-directed mobilization of carbohydrate and lipid from fat body stores, which depends on AKH receptor(s) coupling to cAMP formation and glycogen phosphorylase…

Product Name [Met(O)21] Corticotropin Releasing Factor, ovine Biological activity Corticotropin Releasing Factor, ovine is a corticotropin releasing factor isolated from ovine hypothalamic extracts. Corticotropin releasing factor (CRF) is a hypothalamic hormone, which stimulates the secretion of adrenocorticotrophic hormone (ACTH). Sequence Shortening Sequence Shortening SQEPPISLDLTFHLLREVLE-{Met-O}-TKADQLAQQAHSNRKLLDIA-NH2 Storage Please store the product under the recommended conditions in the…

Product Name Cyclic somatostatin Biological activity Cyclic somatostatin (SRIF-14) is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin is a neuropeptide co-stored with acetylcholine in the cardiac parasympathetic innervation, exerts influences directly on contraction of ventricular cardiomyocytes. Cyclic somatostatin inhibits the contractile response of isoprenaline…

Product Name Peptide YY (PYY) (3-36), Human Biological activity Peptide YY (PYY) (3-36), Human is an endogenous appetite-suppressing peptide that acts as a selective agonist of neuropeptide Y (NPY) Y2 receptor. Peptide YY (PYY) (3-36), Human inhibits intestinal fluid secretion, colonic propulsion, and reduces fecal output in mouse models. Peptide YY (PYY) (3-36), Human inhibits…

Product Name (3,5-Diiodo-Tyr1,D-Ala2,N-Me-Phe4,glycinol5)-Enkephalin Biological activity (3,5-Diiodo-Tyr1,D-Ala2,N-Me-Phe4,glycinol5)-Enkephalin is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 103213-42-9 Sequence Sequence…

Product Name Neuropeptide Y, porcine TFA Biological activity Neuropeptide Y, porcine TFA, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion. Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name human GIP(3-30), amide Biological activity Human GIP(3-30), amide is a high affinity antagonist of the human GIP receptor in vitro. Human GIP(3-30), amide has potential anti-obesity and anti-diabetic effects. Formula Formula C150H226N38O44S CAS Number 1884226-05-4 Appearance Solid Color White to off-white Sequence Sequence Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 Sequence Shortening Sequence Shortening EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2 Storage Sealed storage, away…

Product Name PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) Biological activity PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening,…