Product Name Angiotensinogen (1-14), human Biological activity Angiotensinogen (1-14), human is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides. Molecular Weight 1760.01 Formula Formula C83H122N24O19 CAS Number 104180-23-6 Appearance Solid Color White to off-white Sequence Sequence Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn Sequence Shortening Sequence Shortening DRVYIHPFHLVIHN
Product Name Adrenocorticotropic Hormone (ACTH) (1-39), human acetate Biological activity Adrenocorticotropic Hormone (ACTH) (1-39), human acetate is a full length human adrenocorticotropic hormone. Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Glucagon (19-29), human Biological activity Glucagon (19-29), human is a potent and efficient inhibitor of insulin secretion. Molecular Weight 1352.53 Formula Formula C61H89N15O18S CAS Number 64790-15-4 Appearance Solid Color White to off-white Sequence Sequence Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr Sequence Shortening Sequence Shortening AQDFVQWLMNT
Product Name Prolactin Releasing Peptide (1-31), human acetate Biological activity Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can…
Product Name RFRP-3 (mouse) Biological activity RFRP-3 (mouse) is a functional ortholog of avian gonadotropin inhibitory hormone (GnIH), binding to GPR147. RFRP-3 (mouse) reduces Progesterone synthesis by inhibiting FSHR and key enzymes involved in steroidogenesis (P450scc, 3β-HSD, StAR). RFRP-3 (mouse) induces Apoptosis (increase of p53). RFRP-3 (mouse) also suppresses the ERK signaling pathway. RFRP-3 (mouse)…
Product Name Urocortin, rat Biological activity Urocortin, rat (Urocortin (Rattus norvegicus)) is a neuropeptide and a potent endogenous CRFR agonist with Kis of 13 nM, 1.5 nM, and 0.97 nM for human CRF1, rat CRF2α and mouse CRF2β, respectively. Molecular Weight 4707.26 Formula Formula C206H338N62O64 CAS Number 171543-83-2 Appearance Solid Color White to off-white Sequence…
Product Name Cholecystokinin Octapeptide, desulfated TFA Biological activity Cholecystokinin Octapeptide, desulfated (CCK Octapeptide, desulfated) TFA is a synthetic desulfated Cholecystokinin octapeptide (HY-P0093). Formula Formula C51H63F3N10O15S2 CAS Number 171486-94-5 Appearance Solid Color White to off-white Sequence Sequence Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening DYMGWMDF-NH2 Storage Sealed storage, away from moisture and light, under nitrogen Powder -80??C 2…
Product Name Capa-2 Biological activity Capa-2 is a neuropeptide. Capa-2 activates calcium ion influx, stimulates the production of NO, activates soluble guanylate cyclase (sGC), increases intracellular cGMP, and drives ion and fluid secretion. Capa-2 can be used in studies of diuresis. CAS Number 454186-80-2 Sequence Sequence Ala-Ser-Gly-Leu-Val-Ala-Phe-Pro-Arg-Val-NH2 Sequence Shortening Sequence Shortening ASGLVAFPRV-NH2 Storage Please store…
Product Name Hym-355 Biological activity Hym-355 is a Hydra neuropeptide. Hym-355 can induce oocyte maturation and spawning. CAS Number 267221-91-0 Sequence Sequence H-Phe-Pro-Gln-Ser-Phe-Leu-Pro-Arg-Gly-NH2 Sequence Shortening Sequence Shortening FPQSFLPRG-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Sar1, Ile8]-Angiotensin II Biological activity -Angiotensin II is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels. Formula Formula C46H73N13O10 CAS Number 37827-06-8 Sequence Sequence {SAR}-Arg-Val-Tyr-Ile-His-Pro-Ile Sequence Shortening Sequence Shortening {SAR}-RVYIHPI Storage Please store the product under…
Product Name β-Casomorphin, human TFA Biological activity β-Casomorphin, human TFA (Human β-casomorphin 7 TFA) is an opioid peptide, acts as an agonist of opioid receptor. Molecular Weight 978.02 Formula Formula C46H62F3N7O13 Appearance Solid Color White to off-white Sequence Sequence Tyr-Pro-Phe-Val-Glu-Pro-Ile Sequence Shortening Sequence Shortening YPFVEPI Storage Sealed storage, away from moisture Powder -80??C 2 years…
Product Name CPF-7 Biological activity CPF-7 (Caerulein precursor fragment) is an insulin-releasing peptide that stimulates the release of insulin. CPF-7 can induce epithelial-mesenchymal transition by upregulating Snai1 expression in PANC-1 ductal cells. CPF-7 also induces exocrine plasticity by upregulating Ngn3 expression. CPF-7 can be used in the research of type 2 diabetes. Formula Formula C118H193N33O32…
Product Name Substance P (5-11) Biological activity Substance P (5-11), the C-terminal heptapeptide of Substance P (HY-P0201), is a neuropeptide. Substance P (5-11) binds to NK-1 tachykinin receptor. Formula Formula C41H60N10O9S CAS Number 51165-09-4 Sequence Sequence Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening QQFFGLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of…
Product Name Somatostatin-25 Biological activity Somatostatin-25 is a endogenous neuropeptide hormone that shows inhibitory activity against secretion of growth hormone. Formula Formula C127H191N37O34S3 CAS Number 76461-17-1 Appearance Solid Color White to off-white Sequence Sequence Ser-Asn-Pro-Ala-Met-Ala-Pro-Arg-Glu-Arg-Lys-Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys (Disulfide bridge: Cys14-Cys25) Sequence Shortening Sequence Shortening SNPAMAPRERKAGCKNFFWKTFTSC (Disulfide bridge: Cys14-Cys25) Storage Sealed storage, away from moisture Powder -80??C 2…
Product Name Anaritide Biological activity Anaritide is a synthetic form of atrial natriuretic peptide (ANP) composed of 25 amino acids. Anaritide increases glomerular filtration rate by dilating into and contracting out the bulbar arterioles. Anaritide can be used to study the effects on patients with acute tubular necrosis, particularly in improving dialysis free survival. CAS…
Product Name MTAAAR Biological activity MTAAAR is a polypeptide obtained from the enzymatic hydrolysis of C-phycocyanin (HY-D1025) and possesses neuroprotective activity. MTAAAR enhances the activities of antioxidant enzymes SOD, CAT, and GSH-Px, reduces ROS, inhibits apoptosis and acetylcholinesterase (AChE) activity in brain tissue, and decreases protein carbonyl content. In the MPTP (HY-W114750)-induced zebrafish Parkinson’s disease…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
